Recombinant Human Olfactory receptor 4C46 (OR4C46)

Shipped with Ice Packs
In Stock

Description

Functional Insights

While OR4C46’s specific ligands and physiological roles remain understudied, broader insights into olfactory receptors inform its potential functions:

  • Odorant Detection: ORs bind volatile compounds via transmembrane domains, triggering cAMP-mediated signaling pathways .

  • Sperm Chemotaxis: Some olfactory receptors, including OR4C46, are expressed in spermatozoa and may guide chemotaxis toward oocytes .

  • Genetic Variability: Natural mutations in OR genes (e.g., missense variants) can alter ligand specificity, as observed in population-scale studies .

Research Applications

OR4C46 is primarily used in:

  • Ligand Screening: Identification of odorants or synthetic agonists/antagonists via calcium imaging or cAMP assays .

  • Structural Studies: Modeling GPCR activation mechanisms using computational tools like AlphaFold .

  • Genetic Studies: Investigating single-nucleotide polymorphisms (SNPs) linked to olfactory dysfunction .

Available Reagents

Commercial sources for recombinant OR4C46 include:

SupplierProductTagExpression SystemPurity
Creative BioMartRecombinant Full-Length OR4C46 (1-309 aa)His-taggedE. coli>90%
CusabioOR4C46 Transmembrane ProteinN-terminal HisE. coli>85%
CSB-CF016687HULyophilized OR4C46NoneHEK293 cells>80%

Challenges and Future Directions

  • Ligand Deorphanization: OR4C46 remains an "orphan receptor" with no confirmed ligands .

  • Structural Data: No experimental structures are available; homology modeling is reliant on GPCR templates .

  • Functional Annotation: Classified as a "Tdark" target due to limited pharmacological data .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate this requirement in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. You can use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR4C46; Olfactory receptor 4C46
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
OR4C46
Target Protein Sequence
MENRNNMTEFVLLGLTENPKMQKIIFVVFFVIYIITVVGYVLIVVTITASPSLGSPMYLS LAYLSFIDACYSSVNTPNLITHSLYGKKAILFNGCMTQVFGEHFFGGAEGILLTVMAYDH YVAICKPLHYMTIMNQCVCALLMGVVWMGGFLHATIQILFIFQLPFCGPNVIDHFMCDLN PLLNLACTDTHMLELFIAANSGFICLLNFALLLVSYVVILCSLRTHSLEARHKALSTCVS HITVVILFFVPCIFVYMRPAATLPIDKAVAIFYTMITPMLNPLIYTLKNAQMKNAIRKLC SRKDISGDK
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 31271

KEGG: hsa:119749

STRING: 9606.ENSP00000329056

UniGene: Hs.553564

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of human olfactory receptor OR4C46?

Human olfactory receptor OR4C46, like other olfactory receptors, belongs to the class A rhodopsin-like family of G protein-coupled receptors (GPCRs). The receptor exhibits the canonical structure featuring seven transmembrane domains (7TM) along with three intracellular loops (ICL) and three extracellular loops (ECL) . The N-terminus is positioned extracellularly, while the C-terminus extends into the cytoplasm. The binding pocket for odorant molecules typically forms within the transmembrane bundle, with contributions from specific residues in these domains. Based on structural studies of other olfactory receptors, the transmembrane regions TM-3, TM-5, and TM-6 likely play crucial roles in ligand binding for OR4C46 .

How can researchers effectively generate stable recombinant OR4C46 for functional studies?

Generating stable recombinant OR4C46 presents several challenges common to olfactory receptor expression. Methodologically, researchers should consider:

  • Expression system selection: While HEK293 cells are commonly used, insect cell systems may yield higher protein quantities. The choice of system should be guided by the OR51E2 expression strategy, which successfully produced sufficient protein for structural studies .

  • Expression enhancement: Co-express OR4C46 with trafficking enhancers such as RTP1S, RTP2, REEP1, and Ric-8B to improve surface expression. Additionally, adding N-terminal tags (such as rhodopsin sequences) can enhance membrane targeting.

  • Stabilization strategies: Introduce mutations in highly dynamic regions based on computational predictions to enhance receptor stability without compromising function.

  • Validation approaches: Confirm proper folding and trafficking using confocal microscopy with fluorescently tagged constructs and evaluate functionality through calcium imaging or cAMP assays.

The recent success with OR51E2 structural studies provides a valuable blueprint for producing functional recombinant OR4C46 .

What experimental controls are essential when studying OR4C46 activation?

Robust experimental design for OR4C46 activation studies requires comprehensive controls:

  • Positive controls:

    • Known GPCR agonists activating the same signaling pathway

    • Forskolin for cAMP-based assays

    • Ionomycin for calcium-based assays

  • Negative controls:

    • Vehicle controls (solvent used for odorant dissolution)

    • Mock-transfected cells

    • Cells expressing unrelated ORs

    • Inhibitors of downstream signaling components

  • Expression verification:

    • Immunocytochemistry or western blotting to confirm receptor expression

    • Surface expression quantification

    • mRNA level verification

  • Experimental design considerations:

    • Randomization of sample positions

    • Blinded analysis where possible

    • Adequate biological replicates (minimum n=3) to assess variability

    • Dose-response relationships to establish potency metrics

These controls help distinguish specific OR4C46 activation from non-specific effects, ensuring data reliability and facilitating meaningful interpretation of results .

How should researchers approach the deorphanization of OR4C46?

Deorphanizing OR4C46 (identifying its natural ligands) requires a multi-faceted approach:

  • Computational prediction strategies:

    • Homology modeling based on known OR structures (e.g., OR51E2)

    • Molecular docking with virtual odorant libraries

    • Machine learning approaches using protein chemistry metrics

    • Binding pocket volume analysis to predict compatible ligand sizes

  • High-throughput screening design:

    • Calcium imaging assays with fluorescent indicators

    • cAMP reporter systems (GloSensor, BRET-based)

    • Automated patch-clamp recordings

    • Systematic screening of odorant libraries organized by chemical class

  • Validation methodology:

    • Concentration-response curves for candidate ligands

    • Structure-activity relationship studies with chemical analogs

    • Competition assays with predicted binding site modulators

    • Site-directed mutagenesis of predicted binding residues

Research has shown that more than 80% of olfactory receptors remain orphan receptors, making deorphanization a significant challenge and opportunity in the field . Successful approaches have utilized both computational and experimental techniques, as demonstrated with receptors like OR5K1, OR5M3, and OR8D1 .

What molecular dynamics simulation approaches are most effective for studying OR4C46-ligand interactions?

Molecular dynamics (MD) simulations offer powerful tools for investigating OR4C46-ligand interactions:

  • System preparation methodology:

    • Generate OR4C46 homology model based on related structures

    • Embed receptor in a lipid bilayer mimicking neuronal membranes

    • Solvate with explicit water molecules and physiological ion concentrations

    • Energy minimize and equilibrate the system prior to production runs

  • Binding site characterization techniques:

    • Map electrostatic and hydrophobic surfaces within the binding pocket

    • Analyze water networks and identify displaceable water molecules

    • Monitor pocket volume fluctuations during simulations

    • Identify binding hotspots for specific functional groups

  • Advanced simulation strategies:

    • Metadynamics to explore energy landscapes and binding pathways

    • Gaussian accelerated MD to capture rare conformational events

    • Replica exchange simulations to enhance conformational sampling

    • Free energy calculations to estimate binding affinities

  • Analysis frameworks:

    • Principal component analysis to identify major conformational changes

    • Network analysis to identify allosteric communication pathways

    • Markov state modeling to characterize metastable states

    • Machine learning integration for pattern recognition

Recent studies have demonstrated that molecular dynamics simulation is "a potent and indispensable tool for delving into the intricate dynamics exhibited by biomolecules," providing insights into protein-ligand interactions that may not be captured by static structural methods .

How can researchers distinguish between direct and indirect activation of OR4C46?

Distinguishing direct OR4C46 activation from indirect effects requires methodical experimentation:

  • Biochemical approaches:

    • Direct binding assays with purified receptor (microscale thermophoresis, surface plasmon resonance)

    • Competition studies with known ligands

    • Photo-affinity labeling with derivatized ligands

    • Thermal shift assays to detect ligand-induced stabilization

  • Cellular discrimination strategies:

    • Expression in heterologous systems lacking other ORs

    • Comparison of activation kinetics with known direct activators

    • Co-expression with dominant-negative signaling proteins

    • Genetic knockout of potential indirect pathway components

  • Pharmacological verification:

    • Dose-response relationship characterization

    • Specificity testing across related receptors

    • Antagonist screening and competitive inhibition analysis

    • Allosteric modulator profiling

  • Structural evidence collection:

    • Mutational analysis aligned with binding site models

    • Structure-activity relationships consistent with direct interactions

    • Computational docking and binding energy calculations

    • Conformational change analysis typical of direct activation

Integration of multiple lines of evidence strengthens confidence in classifying compounds as direct OR4C46 ligands rather than indirect modulators of receptor function.

What roles do extracellular loops play in OR4C46 ligand recognition?

Extracellular loops (ECLs) of olfactory receptors, including OR4C46, play critical roles in ligand recognition:

  • ECL2 functional significance:

    • Shapes and regulates the binding pocket volume

    • Maintains the pocket's hydrophobic properties

    • Acts as a gatekeeper for odorant access

    • Contains disulfide bonds critical for structural stability

  • ECL3 contributions:

    • Undergoes conformational changes upon ligand binding

    • Stabilizes odorants during the binding process

    • Transmits structural changes to transmembrane domains

    • Plays a key role in receptor activation

  • Research methodologies to study ECL functions:

    • Alanine scanning mutagenesis of ECL residues

    • Chimeric receptors with ECLs from different ORs

    • Molecular dynamics simulations of ECL mobility

    • Cysteine accessibility scanning

  • Structural insights from related receptors:

    • In OR51E2, ECL3 conformational changes critically contribute to receptor activation

    • ECL3 helps stabilize odorants, facilitating activation

    • ECL flexibility contributes to the diversity of olfactory receptor responses

Recent research has revealed that "conformational alterations within ECL3 play an equally pivotal role in the activation" of olfactory receptors like OR51E2, suggesting similar mechanisms may exist in OR4C46 .

How does the binding pocket volume influence OR4C46 ligand selectivity?

Binding pocket volume significantly influences OR4C46 ligand selectivity through several mechanisms:

  • Size restriction effects:

    • The binding pocket dimensions establish upper limits on ligand size

    • Smaller pockets may enhance selectivity for specific molecular classes

    • Pocket volume can change dynamically during receptor activation

  • Shape complementarity considerations:

    • The three-dimensional contours of the pocket determine fit with ligands

    • Specific binding pocket geometries favor certain molecular scaffolds

    • Key residues creating "pinch points" can discriminate between similar ligands

  • Lessons from OR51E2 structure:

    • OR51E2 shows a binding pocket volume of only 31 ų

    • This small volume selectively accommodates short-chain fatty acids like propionate

    • Mutation of phenylalanine and leucine residues to smaller alanine expands the pocket, enabling binding of longer fatty acids

  • Experimental approaches to study pocket volume:

    • Site-directed mutagenesis to systematically alter pocket dimensions

    • Molecular dynamics simulations to analyze pocket breathing motions

    • Structure-activity relationships with ligands of varying sizes

    • Computational pocket volume analysis and mapping

The relationship between binding pocket volume and ligand selectivity reveals that "the volume of the binding pocket plays a pivotal role in determining the receptor's selectivity for odorant molecules," as demonstrated in OR51E2 studies .

What structural features distinguish OR4C46 from other olfactory receptors?

Structural features distinguishing OR4C46 from other olfactory receptors can be analyzed through several approaches:

  • Sequence-based comparisons:

    • Analysis of variable regions within transmembrane domains

    • Identification of unique residues in binding pocket regions

    • Evolutionary conservation patterns across OR subfamilies

    • Signature motifs specific to the OR4 family

  • Predicted binding pocket characteristics:

    • Volume and shape analysis compared to deorphaned ORs

    • Electrostatic and hydrophobic property mapping

    • Entrance channel architecture and accessibility

    • Distribution of polar and aromatic residues

  • Structural modeling considerations:

    • Homology modeling based on OR51E2 and other GPCR structures

    • AlphaFold2 predictions refined with molecular dynamics

    • Analysis of potentially unique disulfide bridges or salt bridges

    • Identification of distinctive activation triggers

  • Functional correlations:

    • Expression patterns in olfactory epithelium

    • Signal transduction efficiency

    • Adaptation and desensitization properties

    • Response profiles to odorant panels

Recent advances combining "AlphaFold2's 3D protein structure prediction with molecular dynamics simulations" provide powerful tools for identifying distinguishing features of receptors like OR4C46 .

How should researchers address data inconsistencies in OR4C46 activation assays?

Addressing data inconsistencies in OR4C46 activation assays requires systematic approaches:

  • Sources of variability identification:

    • Expression level variations between experiments

    • Cell culture conditions and passage number effects

    • Reagent quality and stability issues

    • Equipment calibration and sensitivity differences

  • Standardization methodologies:

    • Implement consistent receptor expression verification protocols

    • Develop standard operating procedures for all assay steps

    • Use reference compound calibration in each experiment

    • Apply internal control normalization strategies

  • Statistical approaches:

    • Employ outlier detection and handling protocols

    • Conduct normality testing to select appropriate statistical tests

    • Perform variance component analysis to identify major sources of variability

    • Use meta-analysis approaches when combining multiple datasets

  • Experimental design improvements:

    • Implement blocked experimental designs

    • Utilize Latin square or randomized block designs

    • Increase biological and technical replication

    • Include positive and negative controls in every plate

Careful experimental design following principles outlined in the literature is essential for obtaining reliable data, as "the types of biologic inferences that can be drawn from toxicogenomic experiments are fundamentally dependent on experimental design" .

What statistical approaches are most appropriate for analyzing OR4C46 dose-response data?

Statistical analysis of OR4C46 dose-response data requires specialized approaches:

  • Curve fitting methodology:

    • Four-parameter logistic regression (Hill equation) for complete dose-response curves

    • Three-parameter models when appropriate (fixed Hill slope or baseline)

    • Operational models for partial agonists and complex responses

    • Biphasic models for responses with multiple components

  • Parameter extraction and interpretation:

    • EC50 determination with confidence intervals

    • Maximum efficacy (Emax) assessment and comparison

    • Hill coefficient calculation to evaluate cooperativity

    • Baseline response characterization

  • Comparative analysis frameworks:

    • Structure-activity relationship correlations across chemical series

    • Statistical comparison of potency and efficacy parameters

    • Hierarchical clustering of response profiles

    • Principal component analysis of response characteristics

  • Robust statistical considerations:

    • Bootstrap resampling to establish confidence intervals

    • Cross-validation approaches to test model reliability

    • Bayesian hierarchical modeling for complex datasets

    • Mixed-effects models to account for batch variations

How can researchers determine if observed differences in OR4C46 activation are biologically significant?

Determining biological significance of OR4C46 activation differences requires rigorous assessment:

  • Statistical significance evaluation:

    • Power analysis to determine minimum detectable differences

    • Appropriate statistical tests with multiple comparison corrections

    • Effect size calculations beyond p-value reporting

    • Confidence interval analysis for parameter estimates

  • Biological relevance frameworks:

    • Comparison to physiological concentration ranges of odorants

    • Evaluation against known thresholds for olfactory perception

    • Assessment of signal-to-noise ratio in neuronal contexts

    • Comparison with activation profiles of related receptors

  • Validation methodologies:

    • Replication in independent experimental systems

    • Cross-validation with alternative assay technologies

    • Orthogonal measurements of receptor activation

    • In vivo correlation where possible

  • Contextual interpretation:

    • Integration with broader olfactory coding principles

    • Consideration of combinatorial activation patterns

    • Evaluation of temporal response characteristics

    • Assessment of adaptation and sensitization effects

As noted in experimental design literature, "uncertainties about the variability inherent in the assays and in the study populations, as well as interdependencies among the genes and their levels of expression, limit the utility of power calculations" . Therefore, multiple lines of evidence should be integrated to establish biological significance.

How might comparative analysis between OR4C46 and deorphaned ORs accelerate ligand discovery?

Comparative analysis between OR4C46 and deorphaned ORs can significantly accelerate ligand discovery:

  • Binding pocket comparison methodologies:

    • Structural superimposition of binding pocket architectures

    • Identification of conserved and divergent residues

    • Volume and shape analysis of binding cavities

    • Electrostatic and hydrophobicity pattern matching

  • Structure-based pharmacophore development:

    • Extraction of common features from known OR ligands

    • Development of OR subfamily-specific binding models

    • Integration of receptor flexibility information

    • Machine learning refinement of pharmacophore hypotheses

  • Ligand prediction strategies:

    • Similarity-based ligand transfer between related ORs

    • Fragment-based approaches identifying key interaction motifs

    • Network analysis of OR-ligand relationship patterns

    • Protein Chemistry Metric models leveraging sequence-activity relationships

  • Experimental validation approaches:

    • Focused screening of ligands active at related ORs

    • Structure-guided chimeric receptor construction

    • Mutational introduction of binding features from deorphaned ORs

    • Evolutionary trace analysis to identify functionally important residues

Recent research has demonstrated that Protein Chemistry Metric models can achieve "an impressive hit rate of 58%, uncovering 64 novel odorant-OR pairs," highlighting the potential for similar approaches with OR4C46 .

What insights from cryo-electron microscopy studies of other ORs can be applied to OR4C46 research?

Cryo-electron microscopy (cryo-EM) studies of other olfactory receptors provide valuable insights for OR4C46 research:

  • Structural determination strategies:

    • Expression and purification optimization protocols

    • Complex formation with stabilizing antibodies or nanobodies

    • Lipid nanodisc reconstitution approaches

    • Addition of high-affinity ligands to stabilize specific conformations

  • Key structural insights from OR51E2:

    • OR51E2 effectively entraps odorant molecules within a compact binding pocket

    • Both polar interactions (hydrogen/ionic bonds) and hydrophobic interactions contribute to binding

    • The binding mechanism differs significantly from insect odorant-gated ion channels

    • Binding pocket volume critically determines ligand selectivity

  • Activation mechanism understanding:

    • Structural alterations in Extracellular Loop 3 (ECL3) trigger receptor activation

    • Conformational changes propagate from the binding pocket to intracellular domains

    • Specific residues form critical interactions with the bound odorant

    • Dynamic changes in transmembrane domain arrangement during activation

  • Technical considerations for OR4C46:

    • Sample preparation optimization for receptor stability

    • Data collection strategies to address preferred orientation issues

    • Image processing approaches to identify conformational states

    • Integration of AlphaFold2 predictions with experimental data

The recent structural elucidation of OR51E2 provided "groundbreaking insights into the atomic-level structure and mechanisms" of olfactory receptor function, establishing valuable templates for OR4C46 structural studies .

How does OR4C46 research contribute to understanding broader olfactory coding principles?

OR4C46 research contributes to understanding broader olfactory coding principles through multiple dimensions:

  • Receptor tuning mechanisms:

    • Determination of OR4C46's receptive range (narrow vs. broad tuning)

    • Identification of primary molecular features detected

    • Positioning within the multidimensional odor space

    • Contribution to specific olfactory percepts

  • Combinatorial coding insights:

    • Analysis of co-expression patterns with other ORs

    • Assessment of overlapping responsivity with other receptors

    • Identification of unique detection capabilities

    • Investigation of synergistic activation patterns with odorant mixtures

  • Signal transduction characteristics:

    • Comparison of signaling efficiency with other ORs

    • Analysis of adaptation and desensitization properties

    • Characterization of temporal response dynamics

    • Investigation of signal amplification mechanisms

  • Evolutionary perspectives:

    • Conservation analysis across species

    • Identification of selective pressures

    • Assessment of ecological relevance of detected odorants

    • Evaluation of adaptive specialization vs. generalist function

Understanding how individual receptors like OR4C46 function within the larger olfactory system helps reveal how "the olfactory system deciphers and processes specific aromas," ultimately contributing to our knowledge of human sensory mechanisms .

What emerging technologies show the most promise for advancing OR4C46 research?

Several cutting-edge technologies show significant promise for advancing OR4C46 research:

  • Advanced computational approaches:

    • Deep learning models trained on known OR-ligand pairs

    • Protein Chemistry Metric models with demonstrated success rates

    • Quantum mechanical modeling of binding energetics

    • AlphaFold2 integration with molecular dynamics simulations

  • High-throughput cellular technologies:

    • Microfluidic-based single-cell response profiling

    • CRISPR-based screening platforms

    • Nanobody-based biosensors for conformational changes

    • Automated patch-clamp systems with odorant delivery

  • Structural biology innovations:

    • Time-resolved cryo-EM capturing activation intermediates

    • Single-particle analysis with improved resolution

    • Hydrogen-deuterium exchange mass spectrometry

    • Integrative structural biology approaches combining multiple techniques

  • Systems biology integration:

    • Multi-omics approaches linking genotype to chemosensory phenotype

    • Reverse translation from human sensory data to receptor function

    • Comparative genomics across species with different olfactory capabilities

    • Network analysis of OR activation patterns

The combination of these technologies creates powerful research platforms, as "the combination of AlphaFold2's 3D protein structure prediction with molecular dynamics simulations has significantly broadened their applications" in deciphering molecular mechanisms .

What methodological challenges remain in characterizing OR4C46's functional properties?

Despite advances, several methodological challenges remain in characterizing OR4C46:

  • Expression and purification challenges:

    • Limited expression levels typical of olfactory receptors

    • Maintaining functional integrity during solubilization

    • Achieving sufficient protein quantities for structural studies

    • Ensuring proper folding and trafficking to cell membranes

  • Structural characterization limitations:

    • Structural heterogeneity complicating crystallization or cryo-EM

    • Dynamic conformational alterations during activation

    • Resolution barriers for detecting subtle structural changes

    • Capturing physiologically relevant states

  • Ligand identification complexities:

    • Low water solubility of many volatile odorants

    • Difficulty distinguishing direct from allosteric effects

    • Potential for multiple binding modes

    • Limited throughput in functional screening assays

  • Physiological context gaps:

    • Translating in vitro findings to in vivo function

    • Understanding receptor behavior in native membrane environments

    • Accounting for accessory protein interactions

    • Relating receptor activation to perceptual outcomes

These challenges are common across olfactory receptor research, as "the comprehensive structural characterization of numerous human olfactory receptor proteins remains an arduous undertaking today" .

How might OR4C46 research impact applications in fragrance development and food science?

OR4C46 research has potential implications for applications in fragrance development and food science:

  • Fragrance design methodologies:

    • Structure-based design of novel odorants targeting OR4C46

    • Rational modification of known ligands to enhance potency or alter character

    • Computer-aided molecular design based on binding models

    • Development of OR4C46-specific modulators (agonists, antagonists, or allosteric modulators)

  • Food science applications:

    • Identification of natural food compounds activating OR4C46

    • Development of flavor enhancers or masking agents

    • Creation of novel food additives with defined sensory properties

    • Understanding molecular basis of specific food aromas

  • Sensory evaluation correlations:

    • Linking OR4C46 activation patterns to human sensory perception

    • Development of predictive models for sensory properties

    • Identification of OR4C46's contribution to specific odor qualities

    • Correlation between receptor activation kinetics and temporal perception

  • Industrial translation approaches:

    • High-throughput screening methods for industrial application

    • Quality control tools based on receptor activation

    • Bioelectronic "noses" incorporating OR4C46

    • Standardized assays for odor assessment

The deorphaning of olfactory receptors has significant practical applications, as "within the realms of fragrance and food industries, a meticulous grasp of interactions among odor receptors can engender the creation of novel scents, particularly serving as substitutes for food additives" .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.