Recombinant Human Olfactory receptor 4C6 (OR4C6)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Biomedical Relevance

OR4C6 is primarily an odorant receptor but exhibits ectopic expression in non-olfactory tissues, with implications in disease:

Key Findings from Recent Studies

  • Pancreatic Carcinoma: OR4C6 mRNA levels are significantly elevated in pancreatic tumor tissues compared to healthy counterparts, suggesting a potential biomarker role .

  • Breast and Lung Cancers: While OR2B6 is a more prominent biomarker in breast cancer, OR4C6 shows tissue-specific overexpression patterns in other carcinomas .

  • Ligand Interaction Profiling: OR4C6 is cataloged in the M2OR database, which documents OR-odorant pairs, though specific activating ligands remain uncharacterized .

Research Applications of Recombinant OR4C6

Recombinant OR4C6 is critical for:

Table 2: Primary Research Uses

ApplicationExperimental DetailsCitations
Antibody ValidationWestern Blot (WB) at 1:500–1:2000 dilution using human cell lysates
Protein-Protein Interaction StudiesScreening for GPCR signaling partners in heterologous systems (e.g., Hana3A cells)
Disease Biomarker DiscoveryRT-PCR and RNA-Seq profiling in pancreatic carcinoma tissues
Structural BiologyAlphaFold-predicted 3D models for ligand-binding site analysis

Challenges and Future Directions

  • Ligand Deorphanization: OR4C6’s specific odorant ligands are unidentified, necessitating high-throughput screening .

  • Pathological Mechanisms: Its role in pancreatic cancer progression (e.g., proliferation vs. apoptosis) remains unexplored .

  • Assay Optimization: Cross-reactivity with feline tissues is plausible but unconfirmed, requiring epitope mapping .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR4C6; Olfactory receptor 4C6; Olfactory receptor OR11-138
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR4C6
Target Protein Sequence
MENQNNVTEFILLGLTENLELWKIFSAVFLVMYVATVLENLLIVVTIITSQSLRSPMYFF LTFLSLLDVMFSSVVAPKVIVDTLSKSTTISLKGCLTQLFVEHFFGGVGIILLTVMAYDR YVAICKPLHYTIIMSPRVCCLMVGGAWVGGFMHAMIQLLFMYQIPFCGPNIIDHFICDLF QLLTLACTDTHILGLLVTLNSGMMCVAIFLILIASYTVILCSLKSYSSKGRHKALSTCSS HLTVVVLFFVPCIFLYMRPVVTHPIDKAMAVSDSIITPMLNPLIYTLRNAEVKSAMKKLW MKWEALAGK
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 14743

KEGG: hsa:219432

STRING: 9606.ENSP00000324769

UniGene: Hs.511921

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular classification and characterization of OR4C6?

OR4C6 (also known as Olfactory receptor OR11-138) is one of approximately 400 different human olfactory receptors (hORs) that belong to the G-protein coupled receptor 1 family. This receptor is encoded by the OR4C6 gene and plays a role in the human olfactory system's ability to recognize specific odorants .

The receptor contains seven transmembrane domains characteristic of the class A rhodopsin-like family of GPCRs. The standard recombinant form has >85% purity as determined by SDS-PAGE and is typically produced using baculovirus expression systems .

What expression systems are most effective for studying OR4C6?

Expression of human olfactory receptors, including OR4C6, presents significant challenges in heterologous systems. The most commonly used systems include:

Expression SystemAdvantagesLimitationsApplications
HEK293 cellsMammalian processing, suitable for functional assaysVariable expression levelsCalcium imaging, trafficking studies
Baculovirus systemsHigh yield, suitable for structural studiesNon-mammalian processingProtein production for biochemical assays
Xenopus laevis oocytesElectrophysiological recordings possibleLabor-intensiveDetailed functional characterization

For optimal results with OR4C6, studies have shown that specialized approaches like the TAR-Tat system can significantly enhance expression by increasing transcriptional efficiency .

What technical considerations are important for maintaining OR4C6 stability?

The stability of recombinant OR4C6 depends on proper storage and handling conditions:

  • Liquid form stability: Approximately 6 months at -20°C/-80°C

  • Lyophilized form stability: Up to 12 months at -20°C/-80°C

  • Reconstitution recommendation: Deionized sterile water to 0.1-1.0 mg/mL concentration

  • For long-term storage: Addition of 5-50% glycerol (final concentration) with aliquoting

Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week.

How can functional expression of OR4C6 be optimized in experimental systems?

Enhancing functional expression of OR4C6 requires addressing the poor cell surface expression commonly observed with olfactory receptors. Recent methodological advances include:

  • TAR-Tat system implementation: This approach increases transcription efficiency through positive feedback mechanisms, resulting in significantly enhanced cell surface expression and functional response. Studies have demonstrated that this system can uncover previously undetectable odorant-receptor relationships .

  • Trafficking enhancement: Co-expression with accessory proteins that facilitate receptor trafficking to the plasma membrane, such as receptor transporting proteins (RTPs) or receptor expression enhancing proteins (REEPs).

  • Codon optimization: Modification of the coding sequence to optimize for the expression system while maintaining the amino acid sequence.

  • Signal sequence modification: Addition or modification of N-terminal signal sequences to enhance membrane targeting and insertion.

These approaches can be quantitatively evaluated through techniques such as flow cytometry for surface expression and calcium imaging for functional response .

What methodologies are effective for determining OR4C6 ligand specificity?

Determining ligand specificity for OR4C6 requires systematic approaches similar to those used for other olfactory receptors:

  • High-throughput screening: Testing the receptor against odorant libraries like the Henkel 100 mixture, followed by deconvolution to identify active compounds.

  • Calcium imaging: Measuring transient increases in intracellular [Ca²⁺] in response to odorant application in cells expressing OR4C6.

  • Dose-response analysis: Establishing concentration-dependent activation profiles for putative ligands, typically in the micromolar range.

  • Structure-activity relationship studies: Systematic testing of structurally related odorants to map the molecular features required for receptor activation.

  • Competitive binding assays: Determining if multiple odorants compete for binding to the same receptor site.

For example, studies with OR17-40 identified helional as a specific agonist by first testing a mixture of 100 different odorants, then progressively narrowing down to single components . A similar methodological approach would be applicable to OR4C6.

How do genetic variations impact OR4C6 function and evolution?

OR4C6, like other olfactory receptors, is subject to genetic variations that impact its function and evolution:

  • Copy number variations (CNVs): High-resolution CNV mapping has revealed that approximately 50% of CNVs involve more than one OR gene. These variations generate a mosaic of OR dosages across individuals and significantly impact the olfactory repertoire .

  • Pseudogenization: Approximately 55% of human OR genes are pseudogenes. Analysis of OR4C6 should consider whether it is intact and functional in different populations or undergoing pseudogenization.

  • Evolutionary constraints: ORs with close human paralogs or lacking one-to-one orthologs in chimpanzees show enrichment in CNVs, particularly losses over gains, reflecting the diminution of the human OR repertoire compared to other primates .

The analysis of these variations requires comparative genomics approaches combined with functional assays to determine their impact on receptor activity.

What computational approaches aid in understanding OR4C6 structure-function relationships?

Modern computational methods provide valuable insights into OR4C6 structure and function:

  • Homology modeling: Building structural models based on crystallized GPCRs, incorporating the seven transmembrane domain architecture.

  • Molecular docking: Predicting binding modes and affinities of potential ligands in the receptor binding pocket.

  • Molecular dynamics simulations: Investigating conformational changes upon ligand binding and receptor activation.

  • Machine learning approaches: Using algorithms trained on known receptor-ligand pairs to predict potential odorants for OR4C6.

  • Subfamily analysis: Comparing OR4C6 with other members of its subfamily to identify conserved binding residues and predict shared ligand structural features.

These computational predictions should be validated through experimental approaches such as site-directed mutagenesis and functional assays .

How should studies address the poor surface expression of OR4C6?

Addressing the challenge of poor surface expression requires a multi-faceted experimental design:

  • Expression vector optimization: Include elements that enhance transcription efficiency, such as the TAR-Tat system which has been demonstrated to increase functional expression of other olfactory receptors through positive feedback mechanisms .

  • Trafficking enhancement strategies:

    • Co-expression with accessory proteins

    • Addition of trafficking signal sequences

    • N-terminal modifications to improve folding

  • Quantification methods:

    • Surface biotinylation assays

    • Flow cytometry with antibodies against extracellular epitopes

    • Fluorescent protein tagging with pH-sensitive variants to distinguish surface from intracellular receptors

  • Controls and normalization: Include positive controls (other successfully expressed GPCRs) and normalization to total expression levels to accurately assess trafficking efficiency.

What experimental design best captures OR4C6 response characteristics?

To thoroughly characterize OR4C6 responses to odorants:

  • Dual expression system approach: Implement parallel studies in both HEK293 cells and Xenopus laevis oocytes to validate findings across different systems, similar to the approach used for OR17-40 .

  • Response measurement matrix:

MeasurementTechniqueParameterTime Resolution
Calcium signalingFluorescent indicators (Fura-2)Δ[Ca²⁺]ᵢMilliseconds to seconds
cAMP productionFRET-based sensorscAMP levelsSeconds
Membrane potentialPatch clampCurrent/voltageMilliseconds
Receptor internalizationFluorescence microscopySurface/total ratioMinutes
  • Odorant application protocols:

    • Concentration series (typically μM to mM range)

    • Pulse duration optimization (typically 2-10 seconds)

    • Recovery periods between stimulations (3-5 minutes)

    • Control for solvent effects (DMSO, ethanol)

  • Data analysis frameworks:

    • Dose-response curve fitting

    • EC₅₀ determination

    • Desensitization kinetics

    • Response amplitude normalization

How can OR4C6 be studied in the context of the human olfactory receptor subfamily structure?

OR4C6 belongs to one of the 172 subfamilies that compose the human OR family. To understand its role within this context:

  • Comparative sequence analysis:

    • Align OR4C6 with other members of its subfamily (sequence identity ≥60%)

    • Identify conserved and variable residues in binding regions

    • Map these onto structural models to predict functional differences

  • Chromosomal location context:

    • Determine if OR4C6 is located within one of the 51 OR gene loci

    • Analyze whether it is clustered with other members of its subfamily

    • Examine conservation of the locus across primates

  • Subfamily response profiling:

    • Compare response patterns to a panel of odorants across subfamily members

    • Identify shared and distinct ligands within the subfamily

    • Correlate sequence differences with functional differences

This approach helps position OR4C6 within the evolutionary and functional landscape of human olfactory receptors.

What emerging technologies might advance OR4C6 research beyond current limitations?

Cutting-edge approaches that could overcome current limitations in OR4C6 research include:

  • Cryo-EM structural determination: Recent advances in cryo-electron microscopy have enabled the structural determination of previously challenging GPCRs and could be applied to OR4C6, particularly if expression levels can be sufficiently enhanced.

  • Nanobody-based stabilization: Development of nanobodies that stabilize specific conformational states of OR4C6 could facilitate structural studies and provide tools for probing receptor activation.

  • Olfactory receptor arrays: Development of microfluidic devices with immobilized OR4C6 could enable high-throughput screening of odorant libraries.

  • Single-molecule imaging techniques: Tracking the dynamics of individual OR4C6 molecules could provide insights into receptor clustering, diffusion, and interaction with signaling components.

  • Artificial intelligence for virtual screening: Deep learning approaches trained on known olfactory receptor-ligand pairs could predict novel ligands for OR4C6 and guide experimental testing.

These technologies could significantly accelerate our understanding of OR4C6 function and its role in human olfaction.

How should researchers interpret conflicting data on OR4C6 responses?

When encountering conflicting results regarding OR4C6 responses:

  • Systematic comparison of experimental conditions:

    • Expression system variations (HEK293 vs. oocytes vs. other cell lines)

    • Receptor construct differences (tags, fusion proteins)

    • Signal measurement techniques (calcium imaging vs. electrophysiology)

    • Odorant preparation and delivery methods

  • Receptor expression level assessment:

    • Quantify surface expression in each system

    • Normalize responses to expression levels

    • Consider threshold effects for detection

  • Statistical approach:

    • Implement robust statistical methods

    • Calculate confidence intervals for response parameters

    • Perform power analysis to ensure adequate sample sizes

    • Consider Bayesian approaches for integrating prior knowledge

  • Orthogonal validation:

    • Confirm findings using multiple, independent techniques

    • Verify with both functional and binding assays

    • Test in different expression systems

What benchmarks should be used to assess the quality of OR4C6 functional expression?

Quality assessment of OR4C6 functional expression should include:

  • Expression level benchmarks:

    • Surface expression reaching ≥70% of positive control GPCRs

    • Total protein yield ≥0.5 mg/L in recombinant systems

    • Purity ≥85% by SDS-PAGE analysis

  • Functional response criteria:

    • Signal-to-noise ratio ≥3:1 for calcium or cAMP responses

    • Dose-dependent activation with well-defined EC₅₀

    • Response kinetics comparable to well-characterized ORs

    • Reproducible responses across multiple batches and experiments

  • Specificity controls:

    • No activation in mock-transfected cells

    • No cross-activation by vehicle/solvent

    • Distinct response profile compared to related receptors

    • Response consistent across different expression systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.