Recombinant Human Olfactory receptor 4D1 (OR4D1)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

OR4D1 is a G-protein-coupled receptor (GPCR) belonging to the olfactory receptor family, which detects odorant molecules to initiate neuronal signaling for smell perception . The recombinant version (produced in heterologous systems like wheat germ) retains this functionality while enabling standardized experimental studies .

Table 1: Sequence Features

FeatureDetails
N-terminal residuesMEPQNTTQVS
Transmembrane regionsTM1–TM7 with extracellular loops (ECL1–ECL3) and intracellular loops
Post-translational modificationsNone reported in current datasets

Table 2: Recombinant OR4D1 Products

VendorCatalog NumberSizePrice (USD)Expression System
LSBioLS-G33207-1010 µg$479Wheat germ
LSBioLS-G33207-2525 µg$670Wheat germ

These products are used for antibody development, ligand screening, and functional assays .

Spermatozoa Function

  • OR4D1 is expressed in human spermatozoa and testis, where it mediates chemokinetic responses to ligands like 5α-androst-16-en-3-one (a steroid-derived odorant) .

  • Activation triggers calcium signaling via CatSper channels, influencing sperm motility .

Ligand Interactions

  • Synthetic ligands: OR4D1 responds to structurally diverse odorants, though its natural ligands remain partially characterized .

  • Antisense transcripts: RNA-Seq studies detected OR4D1 antisense RNA in spermatozoa, suggesting non-canonical regulatory roles .

Table 3: Key Functional Studies

Study FocusMethodologyKey OutcomeSource
Calcium signalingCalcium imagingOdorant-induced Ca²⁺ influx inhibited by mibefradil PMC
LocalizationImmunocytochemistryOR4D1 detected in sperm midpiece Frontiers

Detection Tools

  • ELISA Kits: Abbexa’s Human OR4D1 ELISA Kit (Detection range: 0.156–10 ng/ml) uses recombinant OR4D1 as a standard for quantitative analysis in biological samples .

Unresolved Questions

  • Physiological ligands: No endogenous ligands confirmed .

  • Structural models: No 3D structures available, limiting mechanistic insights .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
OR4D1; OR4D3; Olfactory receptor 4D1; Olfactory receptor 4D3; Olfactory receptor TPCR16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR4D1
Target Protein Sequence
MEPQNTTQVSMFVLLGFSQTQELQKFLFLLFLLVYVTTIVGNLLIMVTVTFDCRLHTPMY FLLRNLALIDLCYSTVTSPKMLVDFLHETKTISYQGCMAQIFFFHLLGGGTVFFLSVMAY DRYIAISQPLRYVTIMNTQLCVGLVVAAWVGGFVHSIVQLALILPLPFCGPNILDNFYCD VPQVLRLACTDTSLLEFLMISNSGLLVIIWFLLLLISYTVILVMLRSHSGKARRKAASTC TTHIIVVSMIFIPCIYIYTWPFTPFLMDKAVSISYTVMTPMLNPMIYTLRNQDMKAAMRR LGKCLVICRE
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8293

KEGG: hsa:26689

STRING: 9606.ENSP00000365451

UniGene: Hs.531188

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfactory Receptor 4D1 and how does it function in the olfactory system?

Olfactory Receptor 4D1 (OR4D1) is a member of the G-protein coupled receptor 1 family that functions as an odorant receptor. Like other olfactory receptors, OR4D1 is expressed on the surface of olfactory sensory neurons and plays a critical role in the detection and discrimination of odors . When an odorant molecule binds to OR4D1, it triggers a signal transduction cascade that ultimately results in the perception of a specific odor. OR4D1 follows the combinatorial coding principle observed in olfactory perception, where a single receptor can respond to multiple odorants and a single odorant can activate multiple receptors .

How does OR4D1 compare structurally to other human olfactory receptors?

OR4D1, like other human olfactory receptors, belongs to the G-protein coupled receptor 1 family, characterized by seven transmembrane domains . While specific structural data for OR4D1 is limited, olfactory receptors typically contain approximately 320-350 amino acids, with conserved regions that are important for proper folding and function . The variability in the amino acid sequence between different olfactory receptors, including OR4D1, contributes to their specific binding properties and responses to different odorants. This structural diversity is particularly pronounced in the binding pocket regions, which determine odorant specificity .

What expression systems are most effective for producing functional recombinant OR4D1?

  • Cell line selection: HEK293 cells are commonly used, though LNCaP prostate carcinoma cells have shown success with certain ORs that failed to express in HEK293 .

  • Expression enhancement: Co-expression with trafficking proteins like RTP1S, RTP2, REEP1, or Ric-8B can significantly improve surface expression.

  • N-terminal modifications: Adding signal peptides or fusion tags (like Rhodopsin or Lucy) can enhance trafficking to the cell membrane.

  • Culture conditions: Reduced temperature incubation (33°C instead of 37°C) may improve proper folding and surface expression .

Importantly, researchers should be aware that assay-dependent bias can significantly affect OR response profiles, making it essential to validate findings across multiple expression systems .

What are the most reliable bioassay techniques for measuring OR4D1 activation by odorants?

Multiple bioassay techniques can be employed to measure OR4D1 activation, each with distinct advantages and limitations:

Bioassay TypeMeasurement PrincipleAdvantagesLimitationsRecommended Controls
Luciferase Reporter AssayMeasures cAMP-dependent gene expressionHigh throughput, quantitativeIndirect measure of activationEmpty vector, known OR-ligand pairs
Calcium ImagingDetects intracellular Ca²⁺ fluxReal-time response visualizationCannot detect inhibitory responsesIonomycin positive control
BRET/FRET AssaysMeasures protein-protein interactionsDirect measurement of receptor conformational changesTechnically demandingUntagged receptor negative control
Patch Clamp ElectrophysiologyRecords membrane currentsHigh temporal resolution, direct measurementLow throughput, technically challengingMock-transfected cells

The most reliable approach for OR4D1 activation studies typically involves a primary screen using luciferase reporter assays followed by validation with calcium imaging . When possible, native olfactory sensory neurons (OSNs) expressing OR4D1 should be used as a physiologically relevant system to confirm findings from heterologous expression systems .

How should researchers determine optimal ligand concentrations when screening potential OR4D1 agonists?

Determining optimal ligand concentrations for OR4D1 screening requires careful consideration of concentration-dependent effects. Research indicates that olfactory perception changes with odorant concentration, affecting both hedonicity and quality . At the molecular level, increasing ligand concentration enhances the probability of OR activation, potentially converting non-responders to agonists at higher concentrations .

A methodologically sound approach includes:

  • Dose-response experiments: Test a logarithmic range of concentrations (typically 10⁻⁹ to 10⁻³ M) to establish full response profiles.

  • EC₅₀ determination: Calculate the half-maximal effective concentration to characterize potency.

  • Threshold identification: Establish the minimum concentration that produces a statistically significant response above baseline.

  • Saturation assessment: Identify concentrations where response plateaus to avoid receptor desensitization.

Researchers should be aware that screening at a single concentration may miss important response characteristics. For publication-quality data, complete dose-response curves with at least 5-7 concentration points are recommended .

What molecular biology techniques are most effective for manipulating OR4D1 expression for deorphanization studies?

For effective manipulation of OR4D1 expression in deorphanization studies (identifying ligands for orphan receptors), several molecular biology techniques have proven valuable:

  • Vector selection: Mammalian expression vectors with strong promoters (CMV, EF1α) and Kozak sequences optimize expression.

  • Codon optimization: Adjusting codon usage for mammalian expression can increase protein yield significantly.

  • Site-directed mutagenesis: For structure-function studies, targeted mutations can identify critical residues for ligand binding.

  • CRISPR-Cas9 genome editing: For studying OR4D1 in its native context, precise genomic modifications can be introduced.

  • Inducible expression systems: Tet-On/Off systems allow temporal control of OR4D1 expression, reducing potential toxicity.

For deorphanization specifically, high-throughput screening approaches that combine these molecular techniques with functional assays have proven most effective. The success rate can be improved by using chimeric G proteins (like Gα15 or Gα16) to couple receptor activation to calcium signaling pathways that are more easily measured .

How should researchers address variability in OR4D1 responses across different experimental platforms?

Addressing variability in OR4D1 responses requires careful experimental design and data analysis approaches:

  • Standardize experimental conditions: Maintain consistent cell passage numbers, transfection protocols, and assay conditions to minimize technical variability.

  • Perform multiple biological replicates: At least three independent transfections should be performed to account for biological variability.

  • Include appropriate controls: Use known OR-ligand pairs as positive controls and empty vector transfections as negative controls in each experiment.

  • Normalize data appropriately: Consider using relative responses (fold-change over baseline) rather than absolute values when comparing across platforms.

  • Apply statistical methods: Use ANOVA with post-hoc tests for multi-condition comparisons and consider non-parametric tests if data distribution is non-normal.

Researchers should be aware that different assay types (luciferase vs. calcium imaging) or expression systems (HEK293 vs. LNCaP) can produce significantly different response profiles for the same OR-ligand pair . When discrepancies arise, validation in native olfactory sensory neurons represents the gold standard for confirming physiologically relevant interactions.

What computational approaches are recommended for predicting OR4D1-ligand interactions?

Several computational approaches have demonstrated utility for predicting OR4D1-ligand interactions:

Computational MethodApproachStrengthsLimitationsApplication to OR4D1
Homology ModelingBuilds OR4D1 structure based on related GPCRsProvides structural insightsLimited by low sequence identity with crystallized GPCRsPredicts binding pocket architecture
Molecular DockingSimulates ligand binding to receptor modelScores potential interactionsDepends on model qualityScreens candidate ligands in silico
Machine LearningPredicts responses based on known OR-ligand pairsCan identify patterns across large datasetsRequires substantial training dataIdentifies chemical features important for binding
ChemoinformaticsAnalyzes chemical properties of known ligandsIdentifies pharmacophoresMay miss unexpected interactionsGroups potential ligands by similarity

For optimal results, researchers should consider ensemble approaches that integrate multiple computational methods. The M2OR database provides valuable training data for these computational models, containing information on over 51,395 OR-molecule pairs from published literature . When applying these methods to OR4D1, researchers should validate computational predictions with experimental confirmation using the bioassay techniques described previously.

How can researchers differentiate between specific OR4D1 responses and non-specific cellular effects when analyzing activation data?

Differentiating between specific OR4D1 responses and non-specific cellular effects requires rigorous controls and analytical approaches:

  • Empty vector controls: Cells transfected with expression vector lacking OR4D1 help identify non-specific responses to test compounds.

  • Concentration dependence: Specific receptor-mediated responses typically show dose-dependent effects, whereas non-specific effects often occur only at high concentrations.

  • Antagonist validation: If available, specific OR4D1 antagonists should block receptor-mediated but not non-specific responses.

  • Multiple assay formats: Confirming responses using orthogonal assay technologies reduces the likelihood of assay artifacts.

  • Structure-activity relationships: Testing structurally related compounds can confirm specificity (similar compounds should show similar activity profiles).

Statistical approaches to distinguish signal from noise include:

  • Setting response thresholds based on standard deviations above baseline

  • Applying false discovery rate corrections for multiple testing

  • Using machine learning algorithms to identify response patterns characteristic of receptor activation

How does genetic variation in OR4D1 contribute to individual differences in olfactory perception?

Genetic variation in OR4D1, like other olfactory receptors, contributes significantly to individual differences in odor perception. Research indicates that as much as 30% of human olfactory receptors differ between any two individuals . These variations can manifest as:

  • Functional consequences: Single nucleotide polymorphisms (SNPs) in OR4D1 can alter receptor function through:

    • Changes in binding pocket architecture affecting ligand specificity

    • Alterations in expression levels at the cell surface

    • Modifications to signal transduction efficiency

  • Perceptual effects: Variations in OR4D1 can lead to:

    • Different detection thresholds for specific odorants

    • Altered perceived intensity of odors

    • Changes in odor quality perception

    • Variations in hedonic responses (pleasantness/unpleasantness)

Studies of other olfactory receptors have demonstrated that even minor alterations in the functionality of a single receptor can produce notable perceptual consequences . For example, variations in OR10G4 are related to how people perceive the intensity and pleasantness of guaiacol, a molecule with smoky characteristics . Similar studies focusing specifically on OR4D1 variants would help elucidate its contribution to perceptual differences.

To investigate these relationships, researchers should consider psychophysical testing combined with genetic analysis of OR4D1 variants in diverse population samples.

What strategies can overcome challenges in identifying the complete ligand spectrum for OR4D1?

Identifying the complete ligand spectrum for OR4D1 faces several challenges, including the vast chemical space of potential odorants and the context-dependent nature of receptor responses. Effective strategies include:

  • Hierarchical screening approaches:

    • Initial broad screening with structurally diverse odorant panels

    • Focused screening around chemical scaffolds of identified hits

    • Stereoisomer testing to assess stereospecificity

  • Integration of computational methods with experimental validation:

    • Virtual screening to prioritize candidates from large compound libraries

    • Pharmacophore modeling based on initial hits

    • Fingerprint similarity searches to identify related structures

  • Combinatorial approaches:

    • Testing odorant mixtures to identify synergistic effects

    • Antagonist screening to identify compounds that block activation

    • Fragment-based screening to identify binding motifs

  • Leveraging the M2OR database:

    • Analyzing patterns in known OR-ligand pairs to guide OR4D1 screening

    • Applying machine learning models trained on existing data

    • Identifying chemically similar odorants that activate phylogenetically related receptors

What are the current hypotheses regarding the role of OR4D1 in the combinatorial coding of odors?

Current hypotheses regarding OR4D1's role in the combinatorial coding of odors build on the established principle that odorant recognition occurs through a combinatorial code: each odorant activates a subset of receptors, and each receptor responds to multiple odorants . Specific hypotheses relevant to OR4D1 include:

  • Functional clustering hypothesis: OR4D1 may belong to a functional cluster of receptors that collectively encode a specific odor quality or category.

  • Concentration-dependent recruitment: OR4D1 may be recruited into the combinatorial code for certain odorants only at specific concentration ranges, contributing to concentration-dependent changes in odor perception.

  • Temporal coding contribution: OR4D1 may contribute to the temporal aspects of the combinatorial code, with its activation kinetics providing additional information beyond simple on/off responses.

  • Background adaptation role: OR4D1 may participate in adapting the olfactory system to background odors, allowing for detection of novel odorants against varying olfactory backgrounds.

  • Cross-modal integration: OR4D1 activation patterns may contribute to cross-modal sensory integration, influencing how odors interact with other sensory modalities like taste.

Testing these hypotheses requires sophisticated experimental approaches that can measure the activation patterns of multiple receptors simultaneously, including OR4D1, in response to complex odorant mixtures. Advanced techniques such as calcium imaging in receptor arrays, multiplexed recording from olfactory sensory neurons, and computational modeling of receptor network activities are essential tools for this research .

How might emerging technologies advance our understanding of OR4D1 structure-function relationships?

Emerging technologies offer promising avenues for advancing our understanding of OR4D1 structure-function relationships:

  • Cryo-electron microscopy (Cryo-EM): Recent advances in cryo-EM have enabled structural determination of previously challenging membrane proteins, potentially allowing direct visualization of OR4D1 structure in various conformational states.

  • AlphaFold and other AI-based structure prediction: Deep learning approaches have dramatically improved protein structure prediction, offering insights into OR4D1 structure even in the absence of experimental structural data.

  • Nanobody-enabled crystallization: Nanobodies can stabilize GPCRs in specific conformations, potentially facilitating OR4D1 crystallization for high-resolution structural studies.

  • Single-molecule fluorescence resonance energy transfer (smFRET): This technique can track conformational changes in individual OR4D1 molecules during ligand binding and activation.

  • High-throughput mutagenesis with deep sequencing: Systematic mutation of OR4D1 combined with functional assays and deep sequencing can identify critical residues for ligand binding and receptor activation.

  • Molecular dynamics simulations: Improved computational resources allow longer and more accurate simulations of OR4D1-ligand interactions, providing insights into binding kinetics and conformational changes.

These technologies, particularly when used in combination, promise to overcome the historical challenges in studying olfactory receptor structure and function, potentially enabling rational design of specific OR4D1 agonists and antagonists.

What potential applications exist for OR4D1 research beyond basic olfactory science?

OR4D1 research has potential applications extending beyond basic olfactory science:

  • Biomedical applications:

    • Development of novel diagnostics based on altered olfactory function

    • Understanding the molecular basis of specific anosmias (inability to smell certain odors)

    • Identifying genetic factors in idiopathic olfactory disorders

  • Drug discovery applications:

    • OR4D1 as a potential drug target for olfactory modulation

    • Structure-based design of odorant receptor ligands with specific properties

    • Development of receptor-targeted therapies for olfactory disorders

  • Environmental and industrial applications:

    • Development of biosensors using OR4D1 for environmental monitoring

    • Creation of artificial olfactory systems ("electronic noses") incorporating OR4D1

    • Design of new fragrances with targeted receptor activation profiles

  • Neuroscience research tools:

    • OR4D1-based optogenetic tools for manipulating specific olfactory pathways

    • Tracers for mapping neural circuits activated by specific OR4D1 ligands

    • Models for studying neural coding and sensory processing

  • Evolutionary and comparative biology:

    • Understanding selective pressures on OR4D1 evolution across species

    • Insights into human-specific adaptations in olfactory perception

    • Comparative analysis of OR4D1 function across primates

The potential to "digitize" olfaction through understanding the molecular basis of odor perception, including the role of receptors like OR4D1, represents a particularly exciting frontier with applications in virtual reality, communication technologies, and artificial intelligence .

What are the current technical limitations in OR4D1 research and how might they be addressed?

Current technical limitations in OR4D1 research include several challenges that require innovative solutions:

Technical LimitationImpact on ResearchPotential Solutions
Poor surface expression in heterologous systemsReduced signal-to-noise ratio in functional assaysDevelopment of specialized chaperones; optimization of expression tags; cell-free expression systems
Lack of high-resolution structural dataLimited understanding of binding mechanismsApplication of cryo-EM; nanobody-stabilized crystallization; improved computational modeling
Difficulty in predicting ligand specificityInefficient deorphanization processMachine learning approaches trained on expanded datasets; chemoinformatic analysis of odorant properties
Limited physiological context in vitroUncertain relevance to in vivo functionDevelopment of organoid models; improved genetic manipulation of native OSNs; in vivo imaging techniques
Challenge in studying receptor complexesIncomplete understanding of signaling mechanismsAdvanced protein-protein interaction assays; single-molecule tracking; improved co-immunoprecipitation methods
Variability between assay systemsInconsistent results across studiesStandardization of protocols; multi-laboratory validation; comprehensive metadata reporting

Addressing these limitations requires a multidisciplinary approach combining advanced molecular biology techniques, computational methods, and innovative experimental systems. The development of the M2OR database represents an important step in this direction by providing comprehensive information about experimental conditions, concentrations, and stereochemistry, enabling more robust and reproducible research outcomes .

Collaborative efforts between research groups, standardization of experimental protocols, and open sharing of negative results would further accelerate progress in overcoming these technical challenges.

What quality control measures should be implemented when working with recombinant OR4D1?

Implementing rigorous quality control measures is essential when working with recombinant OR4D1:

  • Expression verification:

    • Western blot analysis with specific antibodies or epitope tags

    • Flow cytometry to quantify surface expression levels

    • Immunocytochemistry to confirm proper cellular localization

  • Functional validation:

    • Response to positive control ligands (if known)

    • Dose-dependent activation profiles

    • Specificity testing with structurally related compounds

  • Protein quality assessment:

    • SDS-PAGE to confirm correct molecular weight and purity (≥85%)

    • Mass spectrometry to verify protein integrity

    • Thermal stability assays to assess proper folding

  • Batch consistency:

    • Standardized production protocols

    • Lot-to-lot comparison of activity

    • Reference standards for quantitative comparisons

  • Storage stability monitoring:

    • Activity testing after defined storage periods

    • Freeze-thaw stability assessment

    • Accelerated degradation studies

Researchers should document all quality control measures in detail, including acceptance criteria for each parameter. For recombinant protein preparations, purity of ≥85% as assessed by SDS-PAGE is typically considered suitable for most research applications .

How can researchers troubleshoot common issues in OR4D1 functional expression systems?

Troubleshooting common issues in OR4D1 functional expression systems requires systematic approaches to identify and resolve specific problems:

IssuePotential CausesTroubleshooting Approaches
Low or no expressionPoor transfection efficiency; protein misfolding; rapid degradationOptimize transfection conditions; add proteasome inhibitors; lower incubation temperature; verify plasmid sequence
Surface trafficking failureImproper folding; ER retention; lack of accessory proteinsCo-express RTP1S and other chaperones; add N-terminal trafficking tags; optimize signal peptide
No functional responseInactive receptor; improper G-protein coupling; assay limitationsTest with chimeric G proteins; verify assay components; increase ligand concentration range; check for antagonism
High background signalsEndogenous receptor expression; non-specific cellular responsesUse receptor-null cell lines; include empty vector controls; reduce ligand concentration
Variable responses between experimentsCell passage effects; transfection variability; reagent instabilityStandardize cell culture conditions; use stable cell lines; prepare fresh reagents; increase replication

When troubleshooting, it's advisable to modify one parameter at a time and maintain detailed records of all experimental conditions. Consultation with the M2OR database can provide valuable insights into successful experimental conditions used by other researchers for similar olfactory receptors .

What are the best practices for experimental design in OR4D1 deorphanization studies?

Best practices for experimental design in OR4D1 deorphanization studies include:

  • Comprehensive screening strategy:

    • Begin with diverse odorant panels covering major chemical classes

    • Include both natural and synthetic compounds

    • Test at multiple concentrations (typically 1 μM, 10 μM, and 100 μM)

    • Consider stereochemistry when selecting test compounds

  • Robust controls:

    • Empty vector transfections to establish baseline responses

    • Known receptor-ligand pairs as positive controls

    • Mock stimulations to account for mechanical responses

    • Vehicle controls to identify solvent effects

  • Validation procedures:

    • Confirm hits in multiple independent experiments

    • Establish full dose-response relationships (EC₅₀ values)

    • Verify specificity with structurally related compounds

    • Test identified ligands in alternative assay formats

  • Data analysis considerations:

    • Establish clear criteria for defining "hits" (e.g., >2-fold over baseline with p<0.05)

    • Account for multiple testing when setting statistical thresholds

    • Consider both efficacy (maximum response) and potency (EC₅₀)

    • Look for structure-activity relationships among active compounds

  • Documentation and reporting:

    • Record detailed experimental conditions including cell passage number, transfection method, and assay parameters

    • Document ligand sources, purity, and preparation methods

    • Report both positive and negative results

    • Share raw data when possible to enable meta-analyses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.