Recombinant Human Olfactory receptor 4D2 (OR4D2)

Shipped with Ice Packs
In Stock

Description

Genetic and Molecular Overview

OR4D2 is encoded by the OR4D2 gene located on human chromosome 17 (17p13.3) . Key molecular features include:

FeatureDetail
Gene IDENSG00000255713
Protein UniProt IDP58180
Protein Length312 amino acids
Structural Class7-transmembrane domain GPCR
Subfamily ClassificationOlfactory receptor family 4, subfamily D

OR4D2 is part of the largest multigene family in vertebrates, with over 400 functional olfactory receptors (ORs) in humans .

Table 1: Biophysical Properties of Recombinant OR4D2

PropertyValue/Characterization
Oligomeric StateMonomeric (1.6 mg) and dimeric (1.1 mg) forms
Ligand-Binding RegionExtracellular and transmembrane domains
Conserved MotifsMetal ion-binding sites (e.g., zinc, copper) for odorant recognition

Functional Characteristics

OR4D2 functions in odorant detection through a combinatorial coding mechanism, where multiple ORs collectively recognize odorant structural features . Key functional attributes include:

  • Ligand interactions: Odorant binding induces conformational changes, activating Gₒₗf proteins and downstream cAMP signaling .

  • Ligand specificity: OR4D2 remains an orphan receptor (no confirmed ligands), though homologous ORs detect aliphatic or aromatic compounds .

  • Concentration dependence: Odorant response thresholds vary with ligand concentration, as observed in the M2OR database .

Experimental Models

  • Heterologous assays: HEK293S and Hana3A cell lines enable functional screening via calcium imaging or cAMP assays .

  • Sperm chemotaxis studies: ORs in spermatozoa (e.g., OR1D2) suggest potential roles for OR4D2 in reproductive biology, though direct evidence is lacking .

Challenges in Deorphanization

  • Assay variability: Ligand responses differ across cell lines (e.g., LNCaP vs. HEK293) .

  • Stereochemical sensitivity: Enantiomers may activate ORs differently, complicating ligand identification .

Future Directions

  • Ligand discovery: High-throughput screening using recombinant OR4D2 could identify agonists/antagonists.

  • Structural studies: Cryo-EM or crystallography of OR4D2-ligand complexes .

  • Biomedical relevance: ORs are explored as biomarkers in cancers (e.g., breast, pancreatic), though OR4D2’s role remains unstudied .

References

  1. OR4D2 gene and protein structure

  2. M2OR database and ligand concentration effects

  3. OR subfamily organization and ligand recognition

  4. Heterologous expression and purification techniques

  5. Structural and functional GPCR mechanisms

  6. Odorant receptor roles in non-olfactory tissues

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your preferred format in order notes if needed. We will fulfill requests to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its inclusion.
Synonyms
OR4D2; Olfactory receptor 4D2; B-lymphocyte membrane protein BC2009; Olfactory receptor OR17-24
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
OR4D2
Target Protein Sequence
METGNLTWVSDFVFLGLSQTRELQRFLFLMFLFVYITTVMGNILIIITVTSDSQLHTPMY FLLRNLAVLDLCFSSVTAPKMLVDLLSEKKTISYQGCMGQIFFFHFLGGAMVFFLSVMAF DRLIAISRPLRYVTVMNTQLWVGLVVATWVGGFVHSIVQLALMLPLPFCGPNILDNFYCD VPQVLRLACTDTSLLEFLKISNSGLLDVVWFFLLLMSYLFILVMLRSHPGEARRKAASTC TTHIIVVSMIFVPSIYLYARPFTPFPMDKLVSIGHTVMTPMLNPMIYTLRNQDMQAAVRR LGRHRLV
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8294

KEGG: hsa:124538

STRING: 9606.ENSP00000441354

UniGene: Hs.446879

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural classification of human OR4D2?

Human olfactory receptor 4D2 (also known as B-lymphocyte membrane protein BC2009 or olfactory receptor OR17-24) belongs to the Class A G-protein-coupled receptor (GPCR) family . Like other olfactory receptors, OR4D2 features a characteristic 7-transmembrane domain structure that shares structural homology with various neurotransmitter and hormone receptors . This receptor is encoded by a single coding-exon gene and is part of the largest gene family in the human genome . OR4D2 is classified among the Class II olfactory receptors, which are tetrapod-specific receptors evolved to detect airborne odorants, as opposed to Class I receptors which are considered more "fish-like" in their evolutionary origin .

Where is the OR4D2 gene located in the human genome?

The human OR4D2 gene is located on chromosome 17 at position 53601761-53603689 . It is identified by the gene ID 124538 and has several established identifiers across biological databases, including Ensembl gene ID ENSG00000153951 . The gene encodes a protein (UniProt ID: P58180) that functions as an odorant receptor involved in the molecular recognition of odors and subsequent signal transduction .

How does OR4D2 function in the olfactory system?

OR4D2, like other olfactory receptors, functions by interacting with odorant molecules in the nasal epithelium to initiate a neuronal response that triggers smell perception . The receptor works through a G protein-mediated transduction mechanism where binding of a compatible odorant to the receptor's binding pocket causes conformational changes that activate coupled G proteins . Based on studies of similar olfactory receptors, this likely involves:

  • Odorant binding to a pocket formed by the transmembrane domains

  • Receptor conformational change upon odorant binding

  • Activation of coupled G proteins

  • Initiation of downstream signaling cascades

  • Generation of action potentials in olfactory sensory neurons

While the specific odorants recognized by OR4D2 are not explicitly detailed in the available research, Class II ORs typically recognize diverse structural odorants, potentially including various volatile organic compounds .

What expression systems are most effective for recombinant OR4D2 production?

Recombinant OR4D2 can be expressed in multiple systems, each with distinct advantages for different research applications . The selection of an appropriate expression system depends on the experimental goals:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliHigh yield, cost-effective, rapid productionLimited post-translational modifications, possible improper folding of membrane proteinsProtein fragment production, antibody generation
YeastBetter folding than bacteria, some post-translational modificationsLower yield than E. coliFunctional studies requiring some post-translational modifications
Mammalian cellsNative-like folding and post-translational modificationsHigher cost, lower yield, longer production timeStructural studies, functional assays, protein-protein interaction studies
Insect cellsHigh expression levels for membrane proteins, proper foldingModerate costCrystallography studies, ligand binding assays

What fusion tags are recommended for OR4D2 purification and functional studies?

The choice of fusion tag for recombinant OR4D2 depends on the intended application and purification strategy . Common options include:

Fusion TagPositionBenefitsRecommended Applications
His-TagN or C-terminalEfficient metal affinity purification, small sizeProtein purification, pull-down assays
FLAG-TagN or C-terminalHigh specificity, gentle elution conditionsCo-immunoprecipitation, sensitive detection
GFPTypically C-terminalDirect visualization, folding indicatorLocalization studies, fluorescence-based assays, protein folding assessment
MBPN-terminalEnhanced solubility, affinity purificationImproving solubility of challenging membrane proteins
GSTN-terminalSolubility enhancement, affinity purificationPull-down assays, protein-protein interaction studies

For OR4D2, a C-terminal GFP tag has been successfully used in commercial constructs, suggesting this approach maintains protein functionality . For structural studies, a removable His-tag may be preferable to avoid interference with protein folding or function .

What are the key methodological considerations for purifying functional OR4D2?

Purification of functional OR4D2, like other membrane proteins, requires careful consideration of detergent selection and stabilization strategies:

  • Membrane Extraction: Use mild detergents like DDM (n-Dodecyl β-D-maltoside) or LMNG (Lauryl Maltose Neopentyl Glycol) to solubilize the receptor while maintaining its native conformation.

  • Stabilization Approaches:

    • Addition of cholesterol hemisuccinate (CHS) to stabilize the membrane domain

    • Use of ligands during purification to stabilize active conformations

    • Consider nanodiscs or other membrane mimetics for maintaining a lipid environment

  • Purification Strategy:

    • Initial capture using affinity chromatography (based on the fusion tag)

    • Size exclusion chromatography to separate monomeric protein from aggregates

    • Consider ion exchange chromatography for additional purity if needed

  • Quality Control:

    • SEC-MALS (Size Exclusion Chromatography with Multi-Angle Light Scattering) to verify monodispersity

    • Thermal stability assays to assess protein folding

    • Ligand binding assays to confirm functionality

The inherent instability of olfactory receptors makes their purification challenging, which likely explains why Class II ORs (like OR4D2) have been even more difficult to express and purify than Class I ORs, as noted in structural studies of related receptors .

How can engineered OR4D2 be used to study odorant recognition principles?

Engineered OR4D2 can provide valuable insights into odorant recognition mechanisms through several experimental approaches:

  • Site-Directed Mutagenesis: Systematic mutation of binding pocket residues can identify key amino acids involved in odorant recognition. Based on studies of other olfactory receptors, residues in transmembrane domains 3, 5, and 6 are likely particularly important for ligand specificity .

  • Chimeric Receptor Analysis: Creating chimeric receptors by swapping domains between OR4D2 and other olfactory receptors with known ligand profiles can help identify regions responsible for specificity.

  • Dose-Response Assays: Comparing the activity profiles of wild-type and mutant receptors can reveal how specific residues contribute to both efficacy (maximum response) and potency (EC50) of various odorants .

  • Molecular Docking and MD Simulations: Computational approaches can predict binding modes of potential ligands, which can then be validated experimentally through mutagenesis and functional assays.

Research on related olfactory receptors has shown that Class II ORs like OR4D2 likely recognize odorants through a combination of distributed hydrophobic contacts and a limited set of hydrogen-bonding interactions . Experimental designs should consider both the potential for multiple binding poses and the possibility that different odorants may engage distinct sets of residues within the same binding pocket .

What cellular assays are most reliable for assessing OR4D2 functional activity?

Several cellular assay systems can be employed to assess OR4D2 functionality:

Assay TypePrincipleReadoutAdvantagesLimitations
cAMP AccumulationOR activation leads to cAMP production via adenylyl cyclaseFRET-based cAMP sensors or ELISADirect measure of canonical OR signalingLimited sensitivity
Calcium MobilizationOR activation leads to calcium releaseFluorescent calcium indicatorsHigh sensitivity, real-time kineticsPotential interference from other pathways
β-arrestin RecruitmentActivated ORs recruit β-arrestinBRET or enzyme complementationLigand-specific recruitment patternsMay not detect all activation modes
GloSensor™ AssayLuminescent reporter activated by cAMPLuminescenceHigh sensitivity, real-time kineticsRequires specialized reagents
GIRK Channel CouplingCo-expressed G protein-coupled inwardly rectifying K+ channelsElectrophysiologyDirect measurement of G protein activationTechnical complexity

When designing these assays for OR4D2, researchers should consider:

  • Cell Line Selection: HEK293T cells are commonly used, but specialized lines like Hana3A (with RTP1, RTP2, and REEP1 accessory proteins) may improve surface expression of ORs.

  • Receptor Transport Enhancers: Co-expression with receptor transport proteins (RTPs) and receptor expression enhancing proteins (REEPs) can significantly improve surface expression.

  • Control Receptors: Include well-characterized ORs with known ligands as positive controls.

  • Signal Amplification: Consider strategies to enhance signal detection, such as chimeric G proteins or promiscuous G proteins like Gα15/16.

The integration of multiple assay types provides the most comprehensive characterization of receptor function and ligand interactions .

What are the key considerations for designing OR4D2 ligand discovery experiments?

Designing effective ligand discovery experiments for OR4D2 requires careful consideration of several factors:

  • Compound Library Selection:

    • Include structurally diverse odorants to account for the potentially broad tuning of Class II ORs

    • Consider organizing compounds by chemical features (functional groups, carbon chain length, etc.)

    • Include both natural odorants and synthetic analogs

  • Screening Strategy:

    • Primary screen: Medium-throughput cellular assays (calcium imaging or cAMP detection)

    • Secondary validation: Dose-response relationships for hit compounds

    • Counter-screening: Test hits against related ORs to determine specificity

  • Data Analysis Approach:

    • Calculate integrated area under dose-response curves to capture both efficacy and potency effects

    • Perform structure-activity relationship (SAR) analysis to identify pharmacophores

    • Consider chemoinformatic approaches to build predictive models

  • Validation Methods:

    • Confirm hits with orthogonal assay methods

    • Perform mutagenesis studies to validate binding modes

    • Consider in silico docking to predict binding modes

Based on research with other Class II ORs like OR1A1, researchers should anticipate that OR4D2 may recognize structurally diverse odorants through different binding poses within the same binding pocket . It's also important to note that different odorants may engage different sets of residues, leading to complex structure-activity relationships .

How do the structural dynamics of OR4D2 compare to other Class II olfactory receptors?

Understanding the structural dynamics of OR4D2 in comparison to other Class II olfactory receptors presents a frontier research challenge:

What methodological advances might improve the structural characterization of OR4D2?

Structural characterization of membrane proteins like OR4D2 presents significant technical challenges that might be addressed through emerging methodologies:

  • Protein Engineering Approaches:

    • Thermostabilizing mutations identified through alanine scanning or computational prediction

    • Fusion of crystallization chaperones (e.g., T4 lysozyme, BRIL) into intracellular loops

    • Nanobody or single-chain antibody co-crystallization to stabilize specific conformations

    • Consensus sequence engineering approaches that have proven successful for other ORs

  • Advanced Expression Systems:

    • Baculovirus-infected insect cells with optimized signal sequences and folding enhancers

    • Cell-free expression systems combined with nanodiscs for direct incorporation into membrane mimetics

    • Inducible mammalian expression systems with enhanced quality control mechanisms

  • Novel Solubilization and Stabilization Strategies:

    • Styrene maleic acid lipid particles (SMALPs) for detergent-free extraction

    • Peptidisc library screening for optimal membrane protein stabilization

    • Systematic lipid screening to identify stabilizing lipid environments

    • Computational design of stabilizing ligands that lock receptors in specific conformations

  • Cutting-Edge Structural Biology Methods:

    • Cryogenic electron microscopy (cryo-EM) for structure determination without crystallization

    • Integrative structural biology combining multiple techniques (NMR, HDX-MS, SAXS, computational modeling)

    • Serial femtosecond crystallography at X-ray free-electron lasers for microcrystals

    • Microcrystal electron diffraction (MicroED) for structure determination from nanoscale crystals

The application of these advanced methodologies to OR4D2 could overcome the challenges that have historically limited structural studies of Class II ORs, which have been noted to be even more challenging to express and purify than Class I ORs .

How might the study of OR4D2 inform our understanding of olfactory coding principles?

Investigating OR4D2 within the broader context of the olfactory system can provide insights into fundamental principles of olfactory coding:

  • Receptor Tuning and Combinatorial Coding:
    Class II ORs like OR4D2 likely contribute to combinatorial coding through their ability to recognize multiple odorants with varying affinities. Detailed characterization of OR4D2's ligand specificity could reveal:

    • How broadly or narrowly tuned this receptor is within the olfactory receptor repertoire

    • Which chemical features determine recognition by OR4D2

    • Whether OR4D2 exhibits stereoselectivity (as seen with some ORs discriminating between enantiomers)

  • Structure-Function Relationships:
    The detailed molecular characterization of OR4D2 could reveal conserved and divergent features that explain how the massive sequence diversity of ORs translates to functional diversity:

    • Identification of key residues that determine odorant specificity

    • Understanding how specific amino acid changes in the binding pocket alter recognition profiles

    • Correlation between receptor sequence, 3D structure, and odor perception

  • Evolutionary Perspectives:
    As a Class II OR (tetrapod-specific), OR4D2 evolved to detect airborne odorants . Comparative analysis with evolutionarily related receptors could reveal:

    • How changes in specific residues correlate with changing ecological niches

    • Whether OR4D2 shows evidence of positive selection in humans

    • If OR4D2 has human-specific adaptations compared to orthologs in other primates

  • Translation to Synthetic Biology Applications:
    Understanding the molecular determinants of OR4D2 specificity could enable:

    • Design of olfactory receptor-based biosensors with tailored specificities

    • Engineering of synthetic olfactory systems that mimic or extend natural capabilities

    • Development of new strategies for biosensor applications in environmental monitoring or medical diagnostics

This research direction connects molecular-level understanding to systems-level olfactory coding principles, potentially revealing how the properties of individual receptors like OR4D2 contribute to the complex perceptual experience of smell .

What are the common challenges in achieving functional expression of OR4D2?

Olfactory receptors, including OR4D2, present several expression challenges that researchers should anticipate and address:

  • Poor Surface Expression:
    Olfactory receptors often experience misfolding and retention in the endoplasmic reticulum. This challenge can be addressed through:

    • Co-expression with receptor transport proteins (RTPs) and receptor expression enhancing proteins (REEPs)

    • Use of N-terminal signal sequences from better-expressed GPCRs

    • Addition of N-terminal tags that enhance trafficking (e.g., rhodopsin N-terminal sequence)

    • Codon optimization for the expression system being used

    • Culture at lower temperatures (30-32°C) to slow protein production and allow proper folding

  • Protein Instability:
    Class II ORs like OR4D2 are generally more poorly folded and induce stronger ER stress responses than Class I ORs . Strategies to improve stability include:

    • Addition of chemical chaperones (e.g., DMSO, glycerol) to culture media

    • Inclusion of ligands during expression if known

    • Creation of thermostabilized variants through alanine scanning or computational design

    • Use of specialized expression systems with enhanced folding capabilities

  • Verification of Functional Expression:
    Confirming that expressed OR4D2 is functional requires careful experimental design:

    • Immunofluorescence microscopy to verify surface localization

    • Western blotting with glycosidase treatments to assess maturation

    • Flow cytometry with surface-specific antibodies

    • Functional assays with known ligands or broadly activating compounds

A systematic approach to optimizing these parameters is essential for successful OR4D2 expression studies.

How can researchers overcome the challenges of OR4D2 purification for structural studies?

Purification of OR4D2 for structural studies requires addressing several technical challenges:

  • Detergent Selection and Optimization:
    Finding detergents that extract the receptor while maintaining its native conformation is critical:

    • Screen multiple detergent classes (maltosides, glucosides, neopentyl glycols)

    • Consider detergent mixtures (e.g., DDM/CHS or LMNG/CHS)

    • Optimize detergent concentration and extraction time

    • Test efficiency using fluorescence-detection size-exclusion chromatography (FSEC)

  • Stabilization Throughout Purification:
    Maintaining receptor stability during purification is essential:

    • Include cholesterol or cholesterol analogs throughout purification

    • Add known or putative ligands to stabilize active conformations

    • Consider nanobodies or single-domain antibodies that can stabilize specific conformations

    • Maintain controlled temperature conditions (typically 4°C)

  • Membrane Mimetic Selection for Final Samples:
    The environment for purified OR4D2 significantly affects its stability and activity:

    • Evaluate nanodiscs with different scaffold proteins and lipid compositions

    • Test bicelles of varying compositions

    • Consider amphipols or SMALPs for detergent-free approaches

    • Assess stability using techniques like thermal shift assays

  • Quality Control Metrics:
    Establishing rigorous quality control is essential:

    • SEC-MALS to assess monodispersity and molecular weight

    • Negative-stain EM to verify sample homogeneity

    • Ligand binding assays to confirm functionality

    • Thermal denaturation assays to measure stability

These approaches address the specific challenges noted in structural studies of olfactory receptors, where Class II ORs have proven particularly difficult to express and purify .

What statistical approaches are most appropriate for analyzing OR4D2 ligand screening data?

Rigorous statistical analysis is essential for interpreting data from OR4D2 ligand screening experiments:

  • Dose-Response Analysis:

    • Nonlinear regression to determine EC50 and efficacy parameters

    • Calculation of integrated response metrics that combine potency and efficacy

    • Statistical comparison of curves using extra sum-of-squares F test

    • Application of operational models to distinguish affinity from efficacy

  • High-Throughput Screening Statistics:

    • Z' factor calculation to assess assay quality

    • Use of robust statistics (median, MAD) instead of mean/SD for skewed distributions

    • Implementation of positive percent inhibition normalization

    • Application of B-score methods to correct for positional effects

  • Structure-Activity Relationship Analysis:

    • Principal component analysis of chemical descriptors and activity data

    • Cluster analysis to identify chemical scaffolds with similar activity

    • Random forest or support vector machine approaches for activity prediction

    • Partial least squares or ridge regression for QSAR modeling

  • Binding Mode Analysis:

    • Statistical evaluation of mutagenesis data using thermodynamic mutant cycle analysis

    • Correlation analysis between predicted binding energies and experimental potencies

    • Statistical comparison of different docking poses using experimental validation

The complexity of odorant-receptor interactions, where different odorants may engage distinct sets of residues within the same binding pocket , necessitates sophisticated statistical approaches that can handle this multidimensional data.

How can researchers interpret conflicting data in OR4D2 functional studies?

Discrepancies in OR4D2 functional data may arise from various sources and require systematic investigation:

  • Assay-Dependent Variability:
    Different functional assays may yield apparently conflicting results due to:

    • Measuring different aspects of receptor activation (G protein coupling vs. arrestin recruitment)

    • Varying sensitivity and dynamic range

    • Different kinetic properties (real-time vs. endpoint measurements)

    Resolution Strategy: Employ multiple orthogonal assays and compare the rank order of potency rather than absolute values. Consider using operational models to separate ligand affinity from system-dependent efficacy parameters.

  • Expression System Differences:
    Receptor behavior may vary between expression systems due to:

    • Different membrane compositions affecting receptor conformation

    • Varying levels of accessory proteins and signaling components

    • Post-translational modification differences

    Resolution Strategy: Standardize expression conditions and quantify receptor expression levels. Consider creating stable cell lines to reduce inter-experiment variability.

  • Ligand-Specific Signaling Profiles:
    Apparent contradictions may reflect ligand-specific signaling bias:

    • Different agonists may preferentially activate distinct signaling pathways

    • Some compounds may act as positive allosteric modulators rather than direct agonists

    • Partial agonism vs. full agonism effects

    Resolution Strategy: Employ multiple readouts measuring different signaling pathways and apply bias quantification methods to characterize ligand-specific signaling profiles.

  • Mutation-Induced Conformational Changes:
    When conducting mutagenesis studies, global conformational changes may complicate interpretation:

    • Mutations may affect global receptor stability rather than specific ligand interactions

    • Allosteric effects may propagate throughout the receptor structure

    • Expression levels may be affected by mutations

    Resolution Strategy: Include surface expression measurements for all mutants, conduct double-mutant cycle analysis, and consider computational modeling to predict mutation effects.

Understanding that Class II ORs like OR4D2 likely have complex modes of odorant recognition with different odorants engaging distinct residue sets can help reconcile apparently conflicting data within a more nuanced conceptual framework.

What emerging technologies might advance OR4D2 research in the next decade?

Several cutting-edge technologies are poised to transform research on olfactory receptors like OR4D2:

  • Structural Biology Breakthroughs:

    • Cryo-EM advances enabling structure determination of smaller membrane proteins

    • Integration of AlphaFold2 and other AI-based structure prediction with experimental validation

    • Development of microcrystallization approaches specifically optimized for GPCRs

    • Serial femtosecond crystallography at X-ray free-electron lasers for in situ structural studies

  • Single-Cell and Spatial Transcriptomics:

    • Mapping OR4D2 expression patterns in human olfactory epithelium at single-cell resolution

    • Spatial transcriptomics to understand the topographical organization of OR-expressing neurons

    • Single-cell proteomics to identify co-expressed signaling components

  • Advanced Biosensor Technologies:

    • Development of OR4D2-based cell-free biosensors for environmental or medical applications

    • Integration with microfluidic systems for high-throughput screening

    • Nanobody-based sensors that report on specific OR4D2 conformational states

    • Genetically encoded fluorescent sensors reporting OR activation in real-time

  • Genome Engineering Approaches:

    • CRISPR-based precise genome editing to study OR4D2 function in physiological contexts

    • Development of humanized animal models expressing human ORs including OR4D2

    • Massively parallel functional screening of OR4D2 variants to map sequence-function relationships

    • Creation of synthetic OR arrays with defined properties based on insights from OR4D2 studies

  • Artificial Intelligence Applications:

    • Machine learning approaches to predict OR4D2 ligands based on chemical structure

    • Deep learning integration of structural, functional, and chemical data

    • AI-assisted design of OR4D2 variants with enhanced stability or altered specificity

    • Network analysis approaches to understand OR4D2's place in the broader olfactory coding system

These technologies will enable more comprehensive understanding of how OR4D2 contributes to olfactory perception at molecular, cellular, and systems levels.

How might our understanding of OR4D2 contribute to therapeutic or diagnostic applications?

While basic research on OR4D2 is primarily focused on understanding fundamental principles of olfactory function, several translational applications may emerge:

  • Olfactory Dysfunction Diagnostics:

    • Development of standardized OR4D2 functional assays to assess specific aspects of olfactory perception

    • Genotype-phenotype correlation studies linking OR4D2 variants to specific olfactory deficits

    • Creation of targeted odorant panels for clinical assessment of specific OR pathways

    • Integration into broader olfactory testing batteries for neurological conditions

  • Biosensor Applications:

    • OR4D2-based sensors for environmental monitoring of specific volatile compounds

    • Medical diagnostic tools detecting disease-specific volatile biomarkers

    • Quality control applications in food and beverage industries

    • Integration into electronic nose technologies with enhanced specificity

  • Therapeutic Target Exploration:

    • Investigation of OR4D2 expression in non-olfactory tissues where it may have uncharacterized functions

    • Exploration of potential roles in pathological processes based on expression patterns

    • Development of OR4D2-targeted compounds that modify receptor function in therapeutic contexts

    • Potential applications in neuromodulation or appetite regulation if OR4D2 has relevant functions

  • Personalized Olfactory Medicine:

    • Correlation of genetic variants in OR4D2 with individual differences in odor perception

    • Personalized approaches to treating specific forms of anosmia or hyposmia

    • Tailored olfactory training regimens based on individual receptor genetics

    • Development of compensatory strategies for individuals with specific receptor deficits

The translational potential of OR4D2 research will expand as our understanding of its basic biology advances, potentially revealing unexpected applications beyond the current scope of olfactory research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.