Recombinant Human Olfactory receptor 4D5 (OR4D5)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Classification

Protein Name: Olfactory Receptor 4D5
Gene: OR4D5 (Olfactory Receptor Family 4 Subfamily D Member 5)
UniProt ID: Q8NGN0
Taxonomy: Homo sapiens (Human)
Family: Class A GPCRs (tetrapod-specific odorant receptors)

Key identifiers include:

  • RefSeq Accession: NP_001001965.1

  • STRING Protein ID: 9606.ENSP00000305970

  • HGNC: 14852

Sequence Features

The receptor comprises 310 amino acids with seven transmembrane (TM) helices, characteristic of GPCRs. Key domains include:

RegionResiduesFunctional Notes
N-terminal1-50Signal peptide and TM1
TransmembraneTM1-TM7Odorant-binding pocket formation
ExtracellularECL1-ECL3Ligand interaction and stability
C-terminal291-310Cytoplasmic signaling tail

Full sequence:
MNPANHSQVAGFVLLGLSQVWELRFVFFTVFSAVYFMTVVGNLLIVVIVTSDPHLHTTMYFLLGNLSFLDFCYSSITAPRMLVDLLSGNPTISFGGCLTQLFFFHFIGGIKIFLLTVMAYDRYIAISQPLHYTLIMNQTVCALLMAASWVGGFIHSIVQIALTIQLPFCGPDKLDNFYCDVPQLIKLACTDTFVLELLMVSNNGLVTLMCFLVLLGSYTALLVMLRSHSREGRSKALSTCASHIAVVTLIFVPCIYVYTRPFRTFPMDKAVSVLYTIVTPMLNPAIYTLRNKEVIMAMKKLWRRKKDPIGPLEHRPLH

3D Structure Prediction

AlphaFold models predict a conserved GPCR fold with:

  • A hydrophobic ligand-binding pocket formed by TM3, TM5, and TM6

  • Extracellular loop 2 (ECL2) critical for binding pocket volume regulation

Recombinant Production

Commercial and research-grade OR4D5 is synthesized using heterologous expression systems:

ParameterDetails
ExpressionE. coli in vitro system
PurityHigh-purity detergent-solubilized form (exact yield unspecified)
TagsNone reported in commercial variants
ApplicationsLigand binding assays, structural studies, GPCR signaling research

Ligand Specificity

While OR4D5's exact ligands remain uncharacterized, olfactory receptors generally bind volatile organic compounds via:

  • Hydrogen bonding and π-π stacking (for aromatic compounds)

  • Hydrophobic interactions in transmembrane pockets

Signaling Mechanism

Activation follows the GPCR pathway:

  1. Odorant binding induces conformational changes in TM helices

  2. G-protein (Gα<sub>olf</sub>) coupling triggers cAMP signaling

  3. Signal transduction to olfactory neurons

Research Challenges and Gaps

  1. Ligand Identification: No physiological ligands confirmed for OR4D5 .

  2. Structural Data: No experimental X-ray or cryo-EM structures available (AlphaFold models only) .

  3. Expression Limitations: Low native expression levels complicate purification .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR4D5; Olfactory receptor 4D5; Olfactory receptor OR11-276
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR4D5
Target Protein Sequence
MNPANHSQVAGFVLLGLSQVWELRFVFFTVFSAVYFMTVVGNLLIVVIVTSDPHLHTTMY FLLGNLSFLDFCYSSITAPRMLVDLLSGNPTISFGGCLTQLFFFHFIGGIKIFLLTVMAY DRYIAISQPLHYTLIMNQTVCALLMAASWVGGFIHSIVQIALTIQLPFCGPDKLDNFYCD VPQLIKLACTDTFVLELLMVSNNGLVTLMCFLVLLGSYTALLVMLRSHSREGRSKALSTC ASHIAVVTLIFVPCIYVYTRPFRTFPMDKAVSVLYTIVTPMLNPAIYTLRNKEVIMAMKK LWRRKKDPIGPLEHRPLH
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 14852

KEGG: hsa:219875

STRING: 9606.ENSP00000305970

UniGene: Hs.553639

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression challenges are specific to OR4D5 and other human olfactory receptors?

Human olfactory receptors, including OR4D5, are notoriously difficult to express functionally in heterologous systems. This challenge stems primarily from poor trafficking to the cell surface membrane, which is critical for their function. Most hORs are retained in the endoplasmic reticulum due to misfolding and quality control mechanisms, resulting in minimal surface expression . This necessitates specialized expression systems and optimization strategies beyond standard recombinant protein approaches.

How can the TAR-Tat transcriptional enhancement system improve OR4D5 expression?

The TAR-Tat system represents a breakthrough approach for enhancing olfactory receptor expression by focusing on transcriptional efficiency rather than just membrane trafficking. This system utilizes a positive feedback loop where:

Studies have demonstrated that this approach significantly increases both surface expression and functional activity of multiple hORs, making previously undetectable receptor-ligand interactions measurable . For OR4D5 research, implementing the TAR-Tat system could potentially overcome traditional expression limitations.

Expression Enhancement ApproachMechanismBenefits for OR4D5 Research
TAR-Tat SystemTranscriptional enhancement through positive feedbackIncreased transcript levels leading to higher functional expression
RTP1S Co-expressionPromotes receptor trafficking to membraneImproves surface localization
M3 Receptor Co-expressionEnhances G-protein couplingIncreases signal transduction efficiency

What methodological optimizations should be considered when designing an OR4D5 expression construct?

When designing expression constructs for OR4D5, researchers should consider multiple factors to maximize functional expression:

  • Codon optimization specific to the host expression system

  • Inclusion of N-terminal signal sequences that facilitate membrane insertion

  • Addition of well-characterized epitope tags (like Rho or FLAG) that do not interfere with ligand binding

  • Co-transfection with accessory proteins such as RTP1S (5 ng/well has been effectively used in similar receptor studies)

  • Consideration of Hana3A cells as an expression system, which have been optimized for olfactory receptor expression

Implementing these strategies in combination often yields superior results compared to addressing trafficking issues alone .

What are the most reliable assays for measuring OR4D5 activation in heterologous systems?

The luciferase-based reporter assay represents the gold standard for functional characterization of recombinant olfactory receptors. This methodology involves:

  • Co-transfection of the OR4D5 expression construct with a CRE-luciferase reporter (10 ng/well)

  • Addition of accessory proteins like RTP1S (5 ng/well) and M3 (2.5 ng/well)

  • Inclusion of pRL-SV40 (5 ng/well) for normalization of transfection efficiency

  • Stimulation with potential ligands 24 hours post-transfection

  • Measurement of luminescence after 4 hours of odor exposure

  • Normalization of firefly luciferase values to Renilla luciferase activity

This dual-luciferase approach provides a quantitative readout of receptor activation while controlling for variability in transfection efficiency between experimental wells .

How should dose-response experiments be designed to properly characterize OR4D5-ligand interactions?

Dose-response experiments for OR4D5 should follow a systematic approach:

  • Test concentration ranges from 10 nM to 10 mM of potential ligands

  • Include vector-only controls for each odorant to account for non-specific effects

  • Perform each concentration point in triplicate from the same parent plate of cells

  • Fit data to sigmoidal dose-response curves to determine EC50 values

  • Apply statistical analysis to confirm that activation is significantly different from controls

  • Verify that the 95% confidence intervals of top and bottom parameters do not overlap

  • Ensure the standard deviation of the fitted log EC50 is less than 1 log unit

This comprehensive approach enables reliable determination of ligand potency and efficacy, allowing for accurate comparison between different ligands.

What control experiments are essential when evaluating novel ligands for OR4D5?

When characterizing potential OR4D5 ligands, essential controls include:

  • Empty vector controls transfected with all components except the receptor

  • Known broadly-tuned odorant receptors as positive controls for assay functionality

  • Standard receptor-ligand pairs (e.g., Olfr544 with nonanedioic acid) for cross-plate normalization

  • No-odor controls (vehicle only) to establish baseline receptor activity

  • Multiple replicates across independent transfections to ensure reproducibility

These controls enable researchers to distinguish true OR4D5 activation from assay artifacts, receptor-independent effects, and normal experimental variation.

How can molecular dynamics simulations enhance understanding of OR4D5 ligand interactions?

Molecular dynamics simulations represent a powerful approach for exploring the structural basis of OR4D5-ligand interactions, especially given the challenges in obtaining experimental structures of olfactory receptors. These simulations can:

  • Predict the three-dimensional structure of OR4D5 using AlphaFold2 models as starting points

  • Identify potential binding pockets within the transmembrane domains

  • Simulate ligand docking and binding energetics

  • Reveal conformational changes associated with receptor activation

  • Elucidate the roles of specific amino acid residues in ligand recognition

Recent advances have demonstrated that molecular dynamics simulations can accurately model structural alterations in extracellular loops (particularly ECL3) that occur during olfactory receptor activation, providing mechanistic insights into signal transduction .

What structural features are likely to determine ligand specificity in OR4D5?

Based on recent structural studies of olfactory receptors, key determinants of ligand specificity in OR4D5 likely include:

  • The composition of the ligand-binding pocket formed by transmembrane domains

  • Configuration of extracellular loops, particularly ECL3, which undergoes conformational changes upon ligand binding

  • Specific amino acid residues that form weak, non-selective interactions with odorant molecules

  • Regions that undergo structural alterations leading to pore dilation for ion flow

Rather than strong, selective chemical bonds, olfactory receptors typically form multiple weak interactions with ligands, creating a complex recognition pattern that enables discrimination between structurally related compounds .

How should researchers account for genetic polymorphisms when studying OR4D5?

Genetic variation significantly impacts olfactory receptor function and must be carefully considered in OR4D5 research:

  • Sequence your OR4D5 construct and compare it to reference sequences and known variants

  • Consider testing multiple naturally occurring OR4D5 variants in parallel experiments

  • Be aware that single amino acid changes can dramatically alter receptor sensitivity and ligand specificity

  • Document which specific OR4D5 allele is being used in all publications

  • When interpreting contradictory literature results, examine which OR4D5 variants were employed

Studies have demonstrated that naturally occurring variants of olfactory receptors can exhibit dramatically different functional properties. For example, research with OR10G4 revealed that different alleles showed varying responses to guaiacol, vanillin, and ethyl vanillin, with allele type predicting 15.4% of the variance in perceived intensity .

What approaches can resolve contradictory data regarding OR4D5 ligand specificity?

When faced with contradictory findings regarding OR4D5 ligand responses, consider the following methodological approaches:

  • Standardize experimental conditions across laboratories through detailed protocol sharing

  • Sequence the OR4D5 constructs used to identify potential genetic variations

  • Test multiple OR4D5 alleles against the same ligand panel in identical conditions

  • Investigate the effects of individual SNPs by creating constructs with single mutations in a reference background

  • Employ multiple complementary functional assays beyond the standard luciferase reporter

  • Consider the impact of different accessory proteins used in expression systems

Contradictions often stem from unrecognized genetic variations, differences in expression systems, or variations in experimental protocols rather than true biological discrepancies.

What high-throughput approaches are most effective for identifying novel OR4D5 ligands?

Effective high-throughput screening for OR4D5 ligands can follow this structured approach:

  • Primary Screen:

    • Test a diverse odorant library at a fixed concentration (typically 100 μM)

    • Include control receptors with known responses on each plate

    • Include standard receptor-ligand pairs for normalization

    • Establish clear statistical thresholds for hit identification

  • Secondary Screen:

    • Test the top 5% of hits from the primary screen

    • Use multiple concentrations (1, 10, and 100 μM)

    • Perform each test in triplicate

    • Select compounds for full dose-response characterization

  • Dose-Response Characterization:

    • Test concentrations ranging from 10 nM to 10 mM

    • Include proper controls and technical replicates

    • Apply rigorous statistical analysis to confirm activation

This systematic approach has successfully identified novel ligands for multiple orphan olfactory receptors and can be adapted specifically for OR4D5.

How can deorphanization strategies be optimized specifically for OR4D5?

Deorphanization of OR4D5 (identifying its cognate ligands) requires a multifaceted approach:

  • Employ rational odorant selection based on:

    • Chemical similarity to ligands of phylogenetically related receptors

    • Computational prediction of binding affinity through molecular docking

    • Analysis of odorant receptor response patterns from large-scale screening datasets

  • Consider focused libraries based on:

    • Natural odorants from relevant ecological contexts

    • Structural scaffolds with known activity at other olfactory receptors

    • Chemical diversity to sample broad odorant space

  • Implement parallel orthogonal assays:

    • Calcium imaging in addition to luciferase-based reporting

    • GTP-binding assays to directly measure G-protein activation

    • Conformational sensors to detect receptor structural changes

By combining these approaches, researchers can maximize the likelihood of identifying physiologically relevant OR4D5 ligands while minimizing false positives and negatives .

What statistical approaches are most appropriate for analyzing OR4D5 activation data?

Robust statistical analysis of OR4D5 functional data should include:

  • Normalization strategies:

    • Division of firefly luciferase values by Renilla luciferase activity to control for transfection efficiency

    • Standardization to known receptor-ligand pairs (such as Olfr544/nonanedioic acid) to enable cross-plate comparison

  • Appropriate statistical tests:

    • Extra sums-of-squares test to confirm receptor activation compared to controls

    • Evaluation of 95% confidence intervals for curve fitting parameters

    • Multiple regression analysis when examining effects of genetic variants

  • Quality control criteria:

    • Standard deviation of fitted log EC50 less than 1 log unit

    • Non-overlapping 95% confidence intervals for top and bottom parameters

    • Consistent responses across technical and biological replicates

These approaches ensure reliable interpretation of OR4D5 functional data while minimizing false positive and negative results.

How can researchers accurately quantify surface expression levels of OR4D5?

Accurate quantification of OR4D5 surface expression is critical for interpreting functional data and should employ multiple complementary approaches:

  • Immunocytochemistry with:

    • Antibodies against N-terminal epitope tags (when present)

    • Non-permeabilized conditions to selectively detect surface proteins

    • Quantitative image analysis of fluorescence intensity

  • Cell surface biotinylation assays:

    • Selective labeling of surface proteins with membrane-impermeable biotinylation reagents

    • Streptavidin pull-down followed by immunoblotting

    • Quantification relative to total receptor expression

  • ELISA-based approaches:

    • Antibody-based detection of epitope-tagged receptors in intact cells

    • Comparison to standard curves for absolute quantification

    • Normalization to total protein or cell number

These methods provide complementary data about OR4D5 trafficking efficiency that can be correlated with functional responses to interpret research findings accurately .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.