Recombinant Human Olfactory receptor 4E1 (OR4E1)

Shipped with Ice Packs
In Stock

Description

Overview of OR4E1

OR4E1 (olfactory receptor family 4 subfamily E member 1) is a protein-coding gene located on chromosome 14 (14q11.2) and belongs to the G-protein-coupled receptor (GPCR) family . It features a 7-transmembrane domain structure typical of olfactory receptors, facilitating odorant recognition and signal transduction via G-protein activation .

Production of Recombinant OR4E1

Recombinant OR4E1 is synthesized using heterologous expression systems to enable functional studies:

  • Expression Systems:

    • Escherichia coli (in vitro)

    • Cell-free expression systems

  • Commercial Availability:

    • Offered by suppliers like Cusabio (CSB-CF314427HU) and MyBioSource (MBS7024897, MBS1093330) .

    • Purity and yield data are proprietary but standardized for research use.

Production Challenges

  • Membrane Protein Complexity: Requires chaperones for proper folding in non-native systems .

  • Low Natural Abundance: Native OR4E1 expression in humans is restricted to olfactory neurons .

Role in Olfaction

  • Pharos Database: OR4E1 scores 0 for annotated biological processes, pathways, or drug interactions .

  • M2OR Database: Lists OR4E1 among understudied receptors, with no confirmed agonist/antagonist pairs .

Experimental Relevance

  • GPCR Studies: Used to explore receptor-ligand binding mechanics and signal transduction .

  • Structural Biology: Aids in resolving 7TM domain conformations through recombinant protein crystallography .

Research Limitations and Gaps

  • Ligand Specificity: No confirmed odorants activate OR4E1 in standardized assays (e.g., Hana3A luciferase systems) .

  • Assay Variability: Functional reconstitution in heterologous systems (e.g., HEK293) may not replicate native neuronal environments .

  • Evolutionary Context: Classified as a pseudogene (OR4E1P) in some annotations, complicating functional validation .

Future Directions

  • Deorphanization Efforts: High-throughput screening via databases like M2OR to identify ligands .

  • Cryo-EM Studies: Structural resolution of OR4E1 in lipid bilayers .

  • Transcriptomic Analyses: Clarify pseudogene status and tissue-specific expression .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your desired format when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR4E1; OR4E1P; Olfactory receptor 4E1; Olfactory receptor OR14-43
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR4E1
Target Protein Sequence
MEEAILLNQTSLVTYFRLRGLSVNHKARIAMFSMFLIFYVLTLIGNVLIVITIIYDHRLH TPMYFFLSNLSFIDVCHSTVTVPKMLRDVWSEEKLISFDACVTQMFFLHLFACTEIFLLT VMAYDRYVAICKPLQYMIVMNWKVCVLLAVALWTGGTIHSIALTSLTIKLPYCGPDEIDN FFCDVPQVIKLACIDTPYVLEILIVSNSGLISVVCFVVLVVSYAVILVSLRQQISKGKWK ALSTCAAHLTVVTLFLGHCIFIYSRPSTSLPEDKAVSVFFTAVTPLLNPIIYTLRNEEMK SALNKLVGRKERKEEK
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8296

KEGG: hsa:26687

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the experimental systems available for studying OR4E1 function?

To investigate OR4E1 function, researchers can employ several experimental systems:

  • Heterologous expression systems: Human embryonic kidney (HEK293) or Chinese hamster ovary (CHO) cells can be transfected with OR4E1 expression constructs along with reporter systems to measure receptor activation.

  • In vitro binding assays: Using purified recombinant OR4E1 protein to directly measure binding affinities with potential ligands.

  • Calcium imaging: This technique allows visualization of receptor activation by measuring intracellular calcium flux when the receptor is stimulated by an odorant.

  • Cilia patch-clamp recording: This electrophysiological approach enables direct measurement of OR4E1 activity in native olfactory sensory neurons.

  • Animal models: Transgenic mice expressing human OR4E1 can be generated to study its function in vivo.

These methodologies should be chosen based on specific research questions, with consideration of the challenges in expressing functional olfactory receptors in heterologous systems, which often require specialized accessory proteins to achieve proper trafficking and function.

What are the known ligands for OR4E1?

While the specific ligands for OR4E1 have not been definitively characterized in the provided search results, understanding can be gained by examining related olfactory receptors. Olfactory receptors typically bind to small molecular odorants through a combination of:

  • Hydrophobic interactions

  • Hydrogen bonding

  • Ionic bonds

The binding specificity is often determined by the volume and structural characteristics of the binding pocket. For example, the related receptor OR51E2 has a compact binding pocket (31 ų) that exclusively accommodates short-chain fatty acids like acetic and propionic acid while excluding longer fatty acid chains .

Research on OR4E1 ligand identification would likely involve screening diverse odorant libraries using functional assays such as calcium imaging or cAMP measurements in cells expressing the recombinant receptor.

How does OR4E1 expression change in pathological conditions?

Analysis of single-cell RNA sequencing data has revealed significant changes in OR4E1 expression in certain disease states. In a study of cystic fibrosis (CF) using the CFTR-knockout pig model, OR4E1 was found to be substantially underrepresented in olfactory sensory neurons from CFTR-/- samples compared to wild-type controls (nine CFTR+/+ versus zero CFTR-/- cells) . This suggests that CF pathology might specifically impact the expression of certain olfactory receptors, including OR4E1.

This differential expression pattern contrasts with other olfactory receptors such as OR51E2, which was overrepresented in CF samples (zero CFTR+/+ versus four CFTR-/- cells) . The table below summarizes these expression differences:

Olfactory ReceptorCFTR+/+ (wild-type)CFTR-/- (CF model)Expression Change in CF
OR4E19 cells0 cellsDecreased
OR51E20 cells4 cellsIncreased
OR51E1Similar levelsSimilar levelsNo change

These findings suggest that OR4E1 may serve as a potential marker for olfactory dysfunction in CF and warrants further investigation into the mechanisms underlying this selective reduction.

What structural features distinguish OR4E1 from other olfactory receptors?

While detailed structural information specifically for OR4E1 is limited in the provided search results, we can infer important structural considerations based on related olfactory receptors:

  • Binding pocket characteristics: The size, shape, and amino acid composition of the binding pocket are crucial determinants of odorant specificity. In the case of OR51E2, a small binding pocket (31 ų) restricts binding to short-chain fatty acids .

  • Extracellular loop configurations: The extracellular loops, particularly ECL2 and ECL3, play pivotal roles in shaping the binding pocket and regulating odorant access. ECL2 influences the volume and hydrophobicity of the binding pocket, while ECL3 contributes to stabilizing odorants during receptor activation .

  • Transmembrane domain organization: The arrangement of transmembrane domains 3, 5, and 6 (TM-3, TM-5, and TM-6) has been shown to be particularly important for odorant binding in many olfactory receptors .

Comparative analysis of OR4E1's predicted structure against other olfactory receptors could reveal unique structural features that determine its ligand specificity and signaling properties.

How do post-translational modifications affect OR4E1 function?

Post-translational modifications (PTMs) of olfactory receptors are critical for their proper folding, trafficking, and signaling function. For OR4E1, researchers should consider:

  • N-linked glycosylation: Potential glycosylation sites in the N-terminal and extracellular loops may influence receptor stability and trafficking.

  • Phosphorylation: Phosphorylation sites in the intracellular loops and C-terminus likely regulate receptor desensitization and internalization following activation.

  • Palmitoylation: Cysteine residues in the C-terminal domain may undergo palmitoylation, affecting receptor localization and signaling efficiency.

  • Disulfide bonding: Conserved cysteine residues in the extracellular domains typically form disulfide bonds that stabilize the receptor's tertiary structure.

Experimental approaches to study these modifications include:

  • Site-directed mutagenesis to remove potential modification sites

  • Mass spectrometry to identify and quantify modifications

  • Fluorescence microscopy to track receptor trafficking

  • Functional assays to measure the impact of modifications on signaling

Understanding these modifications is particularly important when producing recombinant OR4E1, as expression systems may differ in their post-translational processing capabilities compared to native olfactory sensory neurons.

What are the optimal conditions for expressing recombinant OR4E1 in heterologous systems?

Expressing functional olfactory receptors in heterologous systems presents significant challenges due to their hydrophobic nature and complex folding requirements. For optimal OR4E1 expression:

  • Expression system selection: HEK293T cells are often preferred due to their high transfection efficiency and robust protein production. Insect cell systems (Sf9, Hi5) using baculovirus vectors can provide higher yields for structural studies.

  • Codon optimization: Adapting the OR4E1 coding sequence to the codon usage bias of the expression host can significantly improve translation efficiency.

  • Fusion partners and tags:

    • N-terminal fusion with rhodopsin or 5-HT receptor sequences can enhance membrane trafficking

    • Addition of a T4-lysozyme or BRIL domain for structural studies

    • C-terminal tags (His, FLAG) for purification and detection

  • Accessory proteins: Co-expression with receptor transporting proteins (RTPs) and receptor expression enhancing proteins (REEPs) significantly improves surface expression of olfactory receptors.

  • Culture conditions:

    • Temperature: Lower temperatures (30°C rather than 37°C) often improve proper folding

    • Induction timing: For inducible systems, induction at higher cell densities

    • Additives: Sodium butyrate (5-10 mM) can enhance expression levels

  • Detergent selection for purification: For structural and binding studies, mild detergents like DDM, LMNG, or GDN best preserve receptor function.

What molecular dynamics simulation approaches are most effective for studying OR4E1-ligand interactions?

Molecular dynamics (MD) simulations have emerged as powerful tools for studying olfactory receptor-ligand interactions . For OR4E1, the following simulation approaches are recommended:

  • System preparation:

    • Starting structure: AlphaFold2-predicted OR4E1 structure

    • Membrane environment: POPC or mixed lipid bilayer

    • Water model: TIP3P with physiological ion concentrations

    • Force field: CHARMM36 or Amber ff14SB for protein; CGenFF or GAFF for ligands

  • Simulation types:

    • Equilibrium MD: 100-500 ns simulations to observe binding pocket dynamics

    • Enhanced sampling: Metadynamics or umbrella sampling to calculate binding free energies

    • Gaussian accelerated MD (GaMD): To capture rare conformational transitions during activation

  • Analysis methods:

    • Binding pocket volume analysis

    • Protein-ligand contact mapping

    • Principal component analysis of receptor dynamics

    • Markov state modeling to identify key intermediate states

  • Integration with experimental data:

    • Validate simulations against site-directed mutagenesis data

    • Use experimental binding affinities to benchmark computational predictions

These approaches have successfully elucidated mechanisms for other olfactory receptors, revealing how structural changes in extracellular loops (particularly ECL3) contribute to receptor activation .

How can single-cell RNA sequencing be optimized for studying OR4E1 expression patterns?

Single-cell RNA sequencing (scRNA-seq) has proven valuable for studying olfactory receptor expression patterns, as demonstrated by the differential expression of OR4E1 observed in cystic fibrosis models . To optimize scRNA-seq for OR4E1 studies:

  • Sample preparation:

    • Gentle tissue dissociation using papain or mild protease cocktails

    • FACS sorting of olfactory sensory neurons using neuronal markers

    • Immediate processing to minimize RNA degradation

  • Platform selection:

    • 10x Genomics Chromium: High throughput but moderate sensitivity

    • Smart-seq2: Lower throughput but higher sensitivity for detecting low-abundance transcripts like OR4E1

    • MARS-seq: Good balance between throughput and sensitivity

  • Bioinformatic analysis pipeline:

    • Deep sequencing (>50,000 reads per cell) to detect low-abundance OR transcripts

    • OR-specific alignment strategies to handle the high sequence similarity between OR genes

    • Normalization methods accounting for the stochastic nature of OR expression

    • Trajectory analysis to capture developmental regulation

  • Validation strategies:

    • RNA in situ hybridization with OR4E1-specific probes

    • smFISH (single-molecule fluorescence in situ hybridization) for quantitative validation

    • Integration with spatial transcriptomics to preserve anatomical context

This optimized approach can reveal the zonation patterns of OR4E1 expression within the olfactory epithelium and identify cell populations where OR4E1 is preferentially expressed.

How does OR4E1 function connect to broader olfactory signaling networks?

OR4E1, like other olfactory receptors, functions within a complex signaling network that converts chemical stimuli into neuronal responses. Key components and connections to consider:

  • Signal transduction cascade:

    • Upon odorant binding, OR4E1 likely undergoes conformational changes that activate the G protein Golf

    • Golf stimulates adenylyl cyclase type III, increasing cAMP levels

    • cAMP opens cyclic nucleotide-gated channels, causing calcium influx

    • Calcium-activated chloride channels further amplify the depolarization

  • One-neuron-one-receptor rule:

    • OR4E1 is likely expressed in a subset of olfactory sensory neurons following the principle of singular expression

    • Neurons expressing OR4E1 converge on specific glomeruli in the olfactory bulb, creating a spatial map of odor quality

  • Integration with other sensory systems:

    • Activity of OR4E1-expressing neurons contributes to combinatorial coding of odors

    • Cross-talk with other sensory modalities (taste, trigeminal) may occur at higher processing levels

  • Adaptation and modulation:

    • OR4E1 signaling is subject to adaptation mechanisms that adjust sensitivity

    • Neuromodulatory systems (including noradrenergic and cholinergic inputs) may regulate OR4E1-mediated responses

Understanding OR4E1's position within this network provides insights into how specific odorants are encoded and how alterations in OR4E1 expression, as observed in cystic fibrosis , might impact olfactory perception.

What are the implications of OR4E1 dysregulation in disease states?

The underrepresentation of OR4E1 in CFTR-/- olfactory sensory neurons suggests potential involvement in disease processes:

  • Cystic fibrosis-related olfactory dysfunction:

    • Selective loss of OR4E1-expressing neurons may contribute to specific olfactory deficits in CF patients

    • The mechanism may involve inflammatory processes known to affect the olfactory epithelium in CF

  • Potential biomarker applications:

    • Changes in OR4E1 expression could serve as early indicators of olfactory epithelium dysfunction

    • Tracking OR4E1-expressing cells might provide a measure of disease progression or treatment efficacy

  • Beyond the olfactory system:

    • Some olfactory receptors show ectopic expression in non-olfactory tissues

    • Investigation of OR4E1 expression in other cell types might reveal unexpected physiological roles

  • Comparative analysis with other conditions:

    • Similar dysregulation patterns might occur in other diseases affecting the olfactory epithelium

    • Neurodegenerative conditions, viral infections, and toxic exposures may impact OR4E1-expressing neurons

Further research is needed to determine whether OR4E1 dysregulation is a cause or consequence of disease processes and whether therapeutic approaches targeting this receptor might have clinical applications.

What are promising future directions for OR4E1 research?

Several promising research directions for OR4E1 include:

  • Comprehensive deorphanization:

    • High-throughput screening to identify specific ligands for OR4E1

    • Structure-activity relationship studies to define the chemical features that activate OR4E1

    • Development of specific agonists and antagonists as research tools

  • Structural biology approaches:

    • Cryo-electron microscopy of OR4E1 in various conformational states

    • Integration of AlphaFold predictions with experimental structural data

    • Comparative analysis with other olfactory receptors to identify unique structural features

  • Genetic associations:

    • Exploration of OR4E1 polymorphisms in relation to olfactory perception

    • Genome-wide association studies linking OR4E1 variants to disease susceptibility

    • Investigation of epigenetic regulation of OR4E1 expression

  • Therapeutic applications:

    • Exploration of OR4E1 as a target for treating olfactory dysfunction

    • Development of OR4E1-based biosensors for environmental monitoring

    • Investigation of OR4E1 in regenerative approaches for the olfactory epithelium

  • Integration with advanced technologies:

    • Application of organ-on-chip models to study OR4E1 in a physiological context

    • CRISPR-based approaches for precise manipulation of OR4E1 expression

    • AI-driven prediction of OR4E1-ligand interactions

These research directions build upon current understanding while pushing the boundaries of olfactory receptor biology and potential applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.