Recombinant Human Olfactory receptor 4F17 (OR4F17)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR4F17; OR4F11P; OR4F18; OR4F19; Olfactory receptor 4F17; Olfactory receptor 4F11; Olfactory receptor 4F18; Olfactory receptor 4F19
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR4F17
Target Protein Sequence
MVTEFIFLGLSDSQGLQTFLFMLFFVFYGGIVFGNLLIVITVVSDSHLHSPMYFLLANLS LIDLSLSSVTAPKMITDFFSQRKVISFKGCLVQIFLLHFFGGSEMVILIAMGFDRYIAIC KPLHYTTIMCGNACVGIMAVAWGIGFLHSVSQLAFAVHLPFCGPNEVDSFYCDLPRVIKL ACTDTYRLDIMVIANSGVLTVCSFVLLIISYTIILMTIQHRPLDKSSKALSTLTAHITVV LLFFGPCVFIYAWPFPIKSLDKFLAVFYSVITPLLNPIIYTLRNKDMKTAIRQLRKWDAH SSVKF
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15381

KEGG: hsa:81099

STRING: 9606.ENSP00000315047

UniGene: Hs.554420

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of human OR4F17?

Human olfactory receptor 4F17 is a multi-pass membrane protein localized to the cell membrane with structural characteristics typical of class A GPCRs. The receptor consists of 305 amino acids with a molecular weight of approximately 34 kDa as observed by SDS-PAGE analysis . Like other olfactory receptors, OR4F17 likely exhibits a 7-transmembrane domain structure similar to many neurotransmitter and hormone receptors . Circular dichroism spectroscopy of related olfactory receptors has shown approximately 50% alpha-helical content, consistent with the expected GPCR architecture . The receptor can exist in monomeric, dimeric, and higher oligomeric states when analyzed by electrophoretic techniques .

What expression systems are most effective for producing recombinant OR4F17?

The most effective systems for recombinant OR4F17 production utilize mammalian cell lines with inducible expression systems. Tetracycline-inducible HEK293S cells have demonstrated successful production of human olfactory receptors . This approach allows controlled expression and typically yields approximately 30 μg of receptor protein per 150 mm tissue culture plate when cultures are induced with tetracycline together with sodium butyrate . For scale-up production, suspension culture in bioreactors has enabled preparation of >10 mg of monomeric olfactory receptor protein with expression yields reaching 3 mg/L of culture medium .

How does OR4F17 compare to other olfactory receptors in the same subfamily?

OR4F17 belongs to a subfamily that includes OR4F4, OR4F5, OR4F11, OR4F18, and OR4F19 . These receptors share significant sequence homology and functional similarity. The nomenclature assigned to these receptors is organism-specific and independent of other species . OR4F17 has been assigned GeneID 81099 and UniProt accession number Q8NGA8 . Comparative studies suggest these receptors may have overlapping but distinct odorant specificity profiles, with OR4F17 specifically shown to interact with androstenone .

What are the optimal conditions for solubilizing and purifying recombinant OR4F17?

For effective solubilization of OR4F17 from mammalian cell membranes, fos-choline-based detergents have demonstrated superior performance. Specifically, fos-choline-14 (N-tetradecylphosphocholine) has been identified as optimal for both solubilization and subsequent purification of human olfactory receptors . The purification process typically involves immunoaffinity chromatography using antibodies against engineered epitope tags, followed by size exclusion chromatography to separate monomeric receptors from oligomeric species . Purification is most successful when performed at 4°C with detergent concentrations maintained above the critical micelle concentration throughout all steps to prevent receptor aggregation.

How can researchers effectively measure ligand binding to purified OR4F17?

Several complementary approaches can be used to measure ligand binding to purified OR4F17:

  • Surface plasmon resonance (SPR) analysis allows real-time monitoring of odorant binding to detergent-solubilized receptor immobilized on sensor chips . This method has successfully demonstrated specific binding of odorants to purified human olfactory receptors.

  • Calcium ion mobilization assays in heterologous cells expressing OR4F17 provide a functional readout of receptor activation . This approach requires expression of the receptor along with appropriate G-protein coupling components.

  • Fluorescence-based ligand binding assays using intrinsic tryptophan fluorescence or environment-sensitive fluorescent probes can detect conformational changes upon ligand binding.

For OR4F17 specifically, androstenone has been identified as a binding partner in pathway databases , making this odorant a logical starting point for binding studies.

What post-translational modifications occur in recombinantly expressed OR4F17?

Recombinant olfactory receptors expressed in mammalian systems undergo several key post-translational modifications that impact their function and stability. Mass spectrometry analysis of purified human olfactory receptors has identified specific modifications . While OR4F17-specific modification data is limited, similar human olfactory receptors show:

  • N-linked glycosylation at consensus N-X-S/T sites, particularly in the N-terminal domain and extracellular loops

  • Phosphorylation of serine and threonine residues in the C-terminal domain and intracellular loops

  • Disulfide bond formation between conserved cysteine residues

These modifications are critical for proper folding, cell surface expression, and signaling capability of the receptor. Expression systems lacking appropriate post-translational processing machinery may yield non-functional receptor proteins.

What strategies are most effective for synthetic gene design of OR4F17?

PCR-based gene assembly has proven effective for synthetic engineering of human olfactory receptor genes . This approach offers several advantages:

  • Codon optimization for the expression host (such as human cell lines)

  • Removal of problematic secondary structures in the mRNA

  • Elimination of cryptic splice sites or other undesired regulatory elements

  • Incorporation of epitope tags for detection and purification

For OR4F17, incorporating a 9-residue bovine rhodopsin affinity tag (e.g., TETSQVAPA) at the C-terminus facilitates detection and purification without compromising receptor function . The synthetic gene should be designed with appropriate restriction sites for subcloning into expression vectors and sequence-verified before use.

How can researchers validate the functional integrity of purified OR4F17?

Validating functional integrity of purified OR4F17 requires multiple complementary approaches:

Validation MethodTechniqueExpected Outcome for Functional OR4F17
Structural integrityCircular dichroism spectroscopy~50% alpha-helical content
Ligand bindingSurface plasmon resonanceSpecific binding to androstenone
Functional couplingGTPγS binding assayIncreased nucleotide exchange upon odorant binding
Thermal stabilityDifferential scanning fluorimetryIncreased melting temperature in presence of ligand
HomogeneitySize exclusion chromatographyMonodisperse peak at expected molecular weight

A functional OR4F17 preparation should demonstrate specific binding to its cognate ligands (such as androstenone) with affinity constants in the micromolar to nanomolar range, consistent with the relatively low affinities typical of olfactory receptors for their odorant ligands.

What are the key considerations for designing OR4F17 functional assays in heterologous cells?

When designing functional assays for OR4F17 in heterologous cells, researchers should consider:

  • Expression system selection: HEK293 cells are commonly used due to their transfection efficiency and low background of endogenous olfactory signaling components .

  • G-protein coupling: OR4F17 couples to GNAL (Golf alpha) in native olfactory neurons . Co-expression of GNAL, GNB1, and GNG13 (G-protein beta-1 and gamma-13 subunits) may be necessary for efficient signal transduction.

  • Readout selection: Calcium mobilization assays using fluorescent indicators provide a robust readout of receptor activation . Alternative approaches include cAMP accumulation assays or BRET/FRET-based sensors for G-protein activation.

  • Positive controls: Include well-characterized olfactory receptor-ligand pairs as positive controls to validate assay performance.

  • Accessory protein consideration: Co-expression of receptor transport proteins (RTPs) or receptor expression enhancing proteins (REEPs) can significantly improve functional expression of olfactory receptors in heterologous systems.

How can researchers address poor expression or misfolding of recombinant OR4F17?

Poor expression or misfolding of OR4F17 can be addressed through several optimization strategies:

  • Temperature modification: Lowering the culture temperature to 30°C after induction can reduce protein synthesis rate and improve folding.

  • Chemical chaperones: Addition of chemical chaperones such as DMSO (1-2%), glycerol (5-10%), or 4-phenylbutyric acid (2-5 mM) to the culture medium can enhance proper folding.

  • Accessory proteins: Co-expression with receptor transport proteins (RTPs) and receptor expression enhancing proteins (REEPs) can significantly increase surface expression of olfactory receptors.

  • N-terminal modifications: Fusion of well-expressed proteins (such as maltose-binding protein or thermostabilized apocytochrome b562) to the N-terminus can improve expression and folding without interfering with odorant binding.

  • Codon optimization: Ensure the synthetic gene is optimized for expression in the host cell system.

For inducible systems, titration of induction conditions is critical - excessive expression often leads to greater aggregation and reduced functional yield .

What approaches can overcome difficulties in detecting OR4F17-ligand interactions?

Detecting OR4F17-ligand interactions can be challenging due to the typically low affinities and transient nature of these interactions. Researchers can overcome these difficulties through:

  • Membrane preparation optimization: Ensure receptor proteins are properly oriented in native-like membrane environments using nanodiscs, liposomes, or amphipols rather than harsh detergents.

  • Stabilizing mutations: Introduction of specific stabilizing mutations identified through alanine-scanning or directed evolution approaches can enhance receptor stability without affecting ligand binding.

  • High-sensitivity detection methods: Utilize label-free technologies such as surface plasmon resonance, bio-layer interferometry, or isothermal titration calorimetry with sufficiently sensitive instruments.

  • Computational screening: Prior computational screening of potential ligands can narrow down candidates for experimental validation.

  • Radiolabeled ligand alternatives: When available, fluorescently labeled ligands can provide alternatives to traditional radiolabeled ligand binding assays.

For OR4F17 specifically, beginning with androstenone as a known interacting odorant provides a positive control for assay development and optimization.

How might structural biology techniques advance our understanding of OR4F17?

Advanced structural biology techniques hold promise for elucidating the detailed molecular architecture of OR4F17:

  • Cryo-electron microscopy (cryo-EM) has revolutionized GPCR structural biology and could be applied to OR4F17 once sufficient quantities of pure, stable receptor can be produced . This would require optimization of expression systems to yield multiple milligrams of receptor.

  • X-ray crystallography remains challenging for olfactory receptors but might be feasible with receptor stabilization approaches such as insertion of thermostabilizing mutations or fusion with crystallization chaperones.

  • Nuclear magnetic resonance (NMR) spectroscopy, particularly solid-state NMR, could provide insights into ligand binding and dynamic conformational changes even without complete structure determination.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map ligand-induced conformational changes and provide insights into binding mechanisms without requiring complete structural determination.

These approaches would significantly advance our understanding of the molecular basis of odorant recognition by OR4F17 and could inform broader principles of olfactory receptor function.

What technologies are emerging for high-throughput deorphanization of olfactory receptors like OR4F17?

Deorphanization—identifying cognate ligands—for OR4F17 and related olfactory receptors can benefit from emerging high-throughput technologies:

  • Cell-based reporter arrays: Multiplexed cell arrays expressing different olfactory receptors coupled to distinct fluorescent reporters allow simultaneous screening of multiple receptor-odorant combinations.

  • Microfluidic approaches: Droplet-based microfluidic platforms enable massively parallel screening of receptor-ligand interactions with minimal sample consumption.

  • Chemoinformatic prediction: Machine learning algorithms trained on known receptor-odorant pairs can predict potential ligands for orphan receptors based on structural similarities.

  • Biosensor development: Integration of purified olfactory receptors into nanomaterial-based sensor platforms allows direct electronic detection of binding events without requiring cellular signaling machinery .

  • CRISPR-based screening: Genome-wide CRISPR screens in cells expressing OR4F17 can identify cellular factors essential for proper trafficking, signaling, and regulation.

These approaches could significantly accelerate the pace of discovery in olfactory receptor research and unlock new applications in biomedical research and biosensor development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.