Recombinant Human Olfactory receptor 4F4 (OR4F4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
OR4F4; Olfactory receptor 4F4; HS14a-1-A; Olfactory receptor OR19-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR4F4
Target Protein Sequence
MVTEFIFLGLSDSQELQTFLFMLFFVFYGGIVFGNLLIVITVVSDSHLHSPMYFLLANLS LIDLSLSSVTAPKMITDFFSQRKVISFKGCLVQIFLLHFFGGSEMVILIAMGFDRYIAIC KPLHYTTIMCGNACVGIMAVAWGIGFLHSVSQLAFAVHLPFCGPNEVDSFYCDLPRVIKL ACTDTYRLDIMVIANSGVLTVCSFVLLIISYTIILMTIQHCPLDKSSKALSTLTAHITVV LLFFGPCVFIYAWPFPIKSLDKFLAVFYSVITPLLNPIIYTLRNKDMKTAIRRLRKWDAH SSVKF
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8301

KEGG: hsa:26682

STRING: 9606.ENSP00000317482

UniGene: Hs.554420

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR4F4 and what is its genomic classification?

Olfactory receptor 4F4 (OR4F4) belongs to the large family of G-protein-coupled receptors (GPCRs) that arise from single coding-exon genes. It is part of the olfactory receptor gene family, which is the largest in the human genome. OR4F4 follows the standard nomenclature for olfactory receptors (OR), with "4F" designating its subfamily classification and "4" indicating its specific member number within that subfamily . The receptor has multiple synonyms in scientific literature, including HS14a-1-A, OR4F18, OLA-7501, and OR19-3 .

What is the structural architecture of OR4F4?

Like other olfactory receptors, OR4F4 exhibits the characteristic 7-transmembrane domain structure common to many neurotransmitter and hormone receptors. This structural arrangement allows the receptor to recognize specific odorant molecules and initiate G protein-mediated signal transduction . The transmembrane domains are connected by intracellular and extracellular loops that contribute to the binding pocket specificity and interaction with downstream signaling proteins.

How does the OR4F4 signaling cascade function in sensory neurons?

The OR4F4 signaling pathway follows the canonical olfactory transduction mechanism where binding of an odorant ligand activates the receptor, leading to G-protein activation (typically Golf), stimulation of adenylyl cyclase, and generation of cAMP. This second messenger opens cyclic nucleotide-gated channels, allowing calcium influx that triggers membrane depolarization . Repolarization occurs through the coordinated action of sodium/calcium exchangers modulated by olfactory marker protein (OMP), potassium-dependent sodium/calcium exchangers, and plasma membrane Ca++-ATPase . This signaling cascade ultimately converts chemical recognition into electrical signals that are processed by the olfactory bulb.

What expression systems are most effective for recombinant OR4F4 functional studies?

Based on successful approaches with other human olfactory receptors, two primary expression systems have proven effective for recombinant OR studies. Human embryonic kidney 293 (HEK293) cells provide a robust platform for mammalian expression, particularly when used with calcium imaging to detect receptor activation . Alternatively, Xenopus laevis oocytes offer an electrophysiological approach where co-expression with reporter channels (such as CFTR) allows measurement of conductance changes in response to odorant stimulation . For OR4F4 specifically, researchers should consider including receptor transporter proteins (RTP1 and RTP2) and receptor expression enhancing protein 1 (REEP1), which facilitate receptor trafficking to the cell surface and recruitment to lipid rafts .

What methodological approaches resolve common challenges in OR4F4 heterologous expression?

Successfully expressing functional olfactory receptors in heterologous systems requires addressing several technical challenges. For OR4F4, researchers should:

  • Optimize codon usage for the expression system being employed

  • Include trafficking-enhancing elements such as the first 20 amino acids of rhodopsin or a signaling sequence at the N-terminus

  • Co-express with RTP1, RTP2, and REEP1 to improve membrane localization

  • Consider adding Homer protein isoforms 1b/c and 3, which bind to proline-rich sequences on proteins associated with calcium signaling

  • Employ high-sensitivity detection methods like calcium imaging with fluorescent indicators or electrophysiological recordings with amplified reporter systems

How can researchers validate OR4F4 function in heterologous expression systems?

Validation of OR4F4 function requires a multi-step approach:

  • Confirm membrane localization through fluorescent tagging and confocal microscopy

  • Verify protein expression through Western blotting using OR4F4-specific antibodies

  • Demonstrate functional response through calcium imaging or electrophysiological recordings upon odorant stimulation

  • Establish dose-response relationships by testing increasing concentrations of putative ligands

  • Confirm specificity through comparative testing with structurally related compounds

  • Use negative controls including mock-transfected cells and cells expressing unrelated receptors

This systematic approach helps distinguish genuine OR4F4 responses from artifacts or non-specific cellular responses.

How does genetic variation in OR4F4 correlate with olfactory phenotypes?

While specific correlations between OR4F4 genetic variants and olfactory phenotypes have not been directly established in the available literature, research on other olfactory receptors provides a methodological framework. High-throughput sequencing approaches have successfully identified associations between genetic variations in multiple OR genes and 276 olfactory phenotypes, including perceived intensity and pleasantness of odors . For OR4F4, researchers should consider employing similar approaches, sequencing the OR4F4 locus across diverse populations and correlating genetic variants with responses to a panel of odorants at different concentrations. This approach has identified functional variations in other ORs that predict intensity perception, pleasantness perception, or both for multiple OR-odorant pairs .

What is known about OR4F4 expression patterns in non-olfactory tissues?

Interestingly, OR4F4 mRNA shows significant augmentation specifically in Parkinson's Disease (PD) female subjects, suggesting a potential gender-specific role in neurodegenerative contexts . This finding aligns with the emerging understanding that olfactory receptors have functions beyond their canonical roles in olfaction. Researchers investigating OR4F4 expression should employ quantitative PCR, RNA-seq, or nanoCAGE technology to characterize expression patterns across different tissues and disease states, with particular attention to neural tissues and gender-specific differences .

What methodological approaches can identify natural ligands for OR4F4?

Identification of OR4F4 ligands should follow a systematic deorphanization strategy:

  • Initial screening with diverse odorant mixtures (e.g., Henkel 100) to identify potential activity

  • Progressive subdivision of active mixtures into smaller groups to isolate individual active compounds

  • Dose-response testing of candidate ligands to determine EC50 values

  • Structure-activity relationship analysis using structurally related molecules to define pharmacophore requirements

  • Verification of specificity by testing identified ligands against cells expressing different ORs

  • Comparison of in vitro responses with perceptual data from human subjects with different OR4F4 genotypes

This approach successfully identified helional and heliotropylacetone as specific ligands for human OR17-40, with structurally related molecules like piperonal and vanillin being ineffective .

How can researchers distinguish between direct and indirect activation of OR4F4?

Distinguishing direct activation from indirect effects requires multiple complementary approaches:

  • Competitive binding assays with labeled ligands to demonstrate direct interaction

  • Site-directed mutagenesis of predicted binding pocket residues to alter receptor response properties

  • Molecular docking simulations to predict ligand-receptor interactions

  • Comparison of activation profiles across different heterologous systems with varying endogenous signaling components

  • Use of specific inhibitors for various components of the signal transduction pathway

  • Testing receptor activation in the presence of varying concentrations of G protein subunits to establish dependence

These approaches help distinguish direct ligand-receptor interactions from effects mediated by cellular components or signaling intermediates.

What is the significance of OR4F4 upregulation in Parkinson's Disease female patients?

The observation that OR4F4 mRNA shows significant augmentation specifically in Parkinson's Disease (PD) female patients suggests a potential gender-specific role in neurodegenerative pathology . This finding raises several important research questions:

  • Whether OR4F4 upregulation is a cause or consequence of PD pathology

  • If hormonal factors mediate the gender-specific expression pattern

  • Whether OR4F4 activation influences dopaminergic neuron function or survival

  • If OR4F4 could serve as a biomarker for early PD detection or disease progression

  • Whether pharmacological modulation of OR4F4 might offer therapeutic benefits

Researchers investigating this correlation should consider sex-stratified analyses and examine potential interactions between OR4F4 signaling and established PD pathways.

How might OR4F4 function in non-chemosensory tissues?

Olfactory receptors expressed in non-chemosensory tissues often serve functions beyond odorant detection. For OR4F4, researchers should investigate:

  • Potential roles in cellular signaling through cAMP and calcium pathways

  • Involvement in cell migration, proliferation, or differentiation

  • Possible regulation of metabolic processes

  • Interactions with tissue-specific signaling pathways

  • Responses to endogenous ligands rather than environmental odorants

Investigation requires tissue-specific conditional knockout models, transcriptomic analysis of affected tissues, and identification of tissue-specific signaling partners.

How can researchers control for common confounding factors in OR4F4 functional studies?

Robust OR4F4 research requires addressing several potential confounding factors:

Confounding FactorControl Strategy
Receptor trafficking issuesCo-expression with RTP1, RTP2, and REEP1
Non-specific cellular responsesInclude mock-transfected controls and cells expressing unrelated receptors
Genetic background effectsUse isogenic cell lines with CRISPR-edited OR4F4 variants
Ligand solubility and stabilityStandardize preparation methods and verify compound integrity by analytical methods
Signal detection sensitivityInclude positive controls with known strong responses
Sequence similarity with other ORsVerify specificity of primers and antibodies against closely related ORs
Gender-specific effectsStratify analyses by sex and control for hormonal factors

Addressing these factors increases reproducibility and reliability of OR4F4 research findings.

What approaches can resolve discrepancies between in vitro OR4F4 function and in vivo perceptual outcomes?

Addressing discrepancies between cellular assays and perceptual outcomes requires multi-level investigation:

  • Compare results across different heterologous expression systems (HEK293 cells vs. Xenopus oocytes)

  • Consider the influence of odorant-binding proteins and enzymes present in nasal mucus but absent in vitro

  • Acknowledge potential differences in receptor expression levels between experimental systems and native olfactory neurons

  • Account for the combinatorial coding of odor perception, as most odorants activate multiple receptors

  • Investigate genetic variations affecting receptor function or expression

  • Consider central processing effects that modify peripheral input signals

Research on other olfactory receptors has demonstrated that differences between in vitro function and perceptual outcomes can reveal important insights about olfactory processing mechanisms .

How might emerging technologies advance OR4F4 research?

Several emerging technologies offer promising applications for OR4F4 research:

  • CRISPR/Cas9 gene editing to create precise OR4F4 variants or knockout models

  • Single-cell transcriptomics to identify co-expression patterns with other signaling components

  • Cryo-electron microscopy to determine OR4F4 structure in different activation states

  • Organoid models incorporating OR4F4-expressing cells to study function in tissue-like contexts

  • High-throughput screening with designer compound libraries to identify novel ligands or antagonists

  • Machine learning approaches to predict structure-activity relationships for OR4F4 ligands

  • Optogenetic tools to control OR4F4 activation with temporal precision

These technologies provide unprecedented opportunities to understand OR4F4 function at molecular, cellular, and systems levels.

What interdisciplinary approaches might yield new insights into OR4F4 biology?

Advancing OR4F4 research will benefit from interdisciplinary collaboration:

  • Computational biology: Molecular dynamics simulations of ligand-receptor interactions

  • Neuroscience: Mapping neural circuits activated by OR4F4 stimulation

  • Clinical research: Correlating OR4F4 variants with disease susceptibility or progression

  • Evolutionary biology: Comparing OR4F4 function across species

  • Pharmacology: Developing selective modulators of OR4F4 activity

  • Bioengineering: Creating biosensors based on OR4F4 for environmental monitoring

  • Behavioral science: Linking OR4F4 function to perceptual and cognitive outcomes

Interdisciplinary approaches will provide comprehensive understanding of OR4F4 function across biological scales.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.