Recombinant Human Olfactory receptor 4F5 (OR4F5)

Shipped with Ice Packs
In Stock

Description

Recombinant Production Systems

OR4F5 has been expressed in multiple heterologous systems for research applications:

Expression Platforms

SystemHostTagPurityYieldSource
BacterialE. coliHis-tag>90%0.1–1.0 mg/mLCreative BioMart
Plant-BasedNicotiana tabacumStrep-tag>70%CustomizedAntibodies-Online
MammalianHEK-293His-tag>90%Not specifiedGeneBioSystems

Key Notes:

  • E. coli-derived OR4F5 is supplied in Tris/PBS buffer with 6% trehalose (pH 8.0) for stability .

  • Plant-based systems (ALiCE®) enable post-translational modifications absent in bacterial systems .

Ligand Interactions

No physiological ligands have been conclusively identified, though OR4F5 is hypothesized to bind volatile odorants due to its extracellular loop architecture .

Antibody Validation Data

Anti-OR4F5 antibodies (e.g., Boster Bio A30873) show:

  • Western Blot: Positive detection in MCF-7 cell lysates .

  • Cross-Reactivity: Validated for human, mouse, and rat tissues; unconfirmed for goat .

  • Fixation Compatibility: Optimal results with fresh paraformaldehyde (PFA) .

Research Applications

ApplicationExperimental UseCitation
Signal TransductionGPCR pathway analysis via cAMP or calcium assays
Structural StudiesMutagenesis of transmembrane domains (e.g., TM3, TM6)
ImmunohistochemistryLocalization in human urinary bladder frozen sections
Drug ScreeningHigh-throughput ligand binding assays

Unresolved Questions

  • Ligand Specificity: No high-affinity ligands reported to date .

  • Pathway Involvement: Potential roles in non-olfactory tissues remain unexplored .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
OR4F5; Olfactory receptor 4F5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR4F5
Target Protein Sequence
MVTEFIFLGLSDSQELQTFLFMLFFVFYGGIVFGNLLIVITVVSDSHLHSPMYFLLANLS LIDLSLSSVTAPKMITDFFSQRKVISFKGCLVQIFLLHFFGGSEMVILIAMGFDRYIAIC KPLHYTTIMCGNACVGIMAVTWGIGFLHSVSQLAFAVHLLFCGPNEVDSFYCDLPRVIKL ACTDTYRLDIMVIANSGVLTVCSFVLLIISYTIILMTIQHRPLDKSSKALSTLTAHITVV LLFFGPCVFIYAWPFPIKSLDKFLAVFYSVITPLLNPIIYTLRNKDMKTAIRQLRKWDAH SSVKF
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 14825

KEGG: hsa:79501

STRING: 9606.ENSP00000334393

UniGene: Hs.554500

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR4F5 and what is its role in olfactory signaling?

OR4F5 (Olfactory Receptor Family 4 Subfamily F Member 5) is a protein-coding gene that produces an olfactory receptor protein. Olfactory receptors like OR4F5 interact with odorant molecules in the nose to initiate neuronal responses that trigger the perception of smell . These receptors are members of a large family of G-protein-coupled receptors (GPCRs) arising from single coding-exon genes .

The OR4F5 protein features a 7-transmembrane domain structure shared with many neurotransmitter and hormone receptors, responsible for the recognition and G protein-mediated transduction of odorant signals . The olfactory receptor gene family is the largest in the human genome, highlighting the complexity of our sense of smell.

When an odorant binds to OR4F5, it triggers a conformational change in the receptor, activating associated G proteins and initiating a signaling cascade that ultimately leads to action potential generation in olfactory sensory neurons.

What is the genomic location and structure of the OR4F5 gene?

The OR4F5 gene is located on the short arm of chromosome 1 at position p36.33 (1p36.33) . This region is at the terminal end of chromosome 1, with the gene spanning from position 65419 to 71585 on chromosome 1 (NC_000001.11) .

The gene structure consists of 3 exons in total . This genomic organization is particularly notable as OR4F5 is one of the first genes on chromosome 1, making it an interesting subject for studies on chromosome structure and evolution.

FeatureDetails
Chromosome1
Positionp36.33
Coordinates65419..71585
Number of exons3
Gene ID79501

How should recombinant OR4F5 be stored and handled in the laboratory?

Proper storage and handling of recombinant OR4F5 protein is essential to maintain its stability and functional integrity:

Storage ConditionRecommendation
Short-term storage-20°C
Extended storage-20°C or -80°C
Working solutions4°C for up to one week
Buffer compositionTris-based buffer with 50% glycerol, optimized for OR4F5

Critical handling considerations include:

  • Avoid repeated freezing and thawing cycles, as this leads to protein denaturation and activity loss

  • Prepare working aliquots to minimize freeze-thaw cycles

  • When working with antibodies against OR4F5, store at -20°C for long-term (one year) or at 4°C for short-term use (up to one month)

These storage conditions are designed to minimize protein degradation and maintain the functional integrity of the recombinant protein for experimental applications.

What experimental applications are suitable for studying OR4F5 function?

Several experimental applications are appropriate for investigating OR4F5 function, with selection depending on your specific research questions:

ApplicationMethodologyRecommended Parameters
Western Blotting (WB)Detection of OR4F5 protein expression in tissue/cell lysatesAntibody dilution: 1:500-1:2000
ELISAQuantitative measurement of OR4F5 protein levelsAntibody dilution: 1:5000
Calcium ImagingMeasurement of intracellular calcium flux upon receptor activationRequires expression in heterologous system (e.g., HEK293)
Patch-Clamp ElectrophysiologyDirect measurement of receptor-mediated electrical responsesProvides high temporal resolution for signaling studies
Gene Expression AnalysisAnalysis of OR4F5 expression across different conditionsTools like easyGEO can analyze expression patterns

When designing OR4F5 experiments, consider challenges associated with expressing functional olfactory receptors in heterologous systems, including proper trafficking to the cell membrane and coupling to appropriate G proteins. The observed molecular weight (72 kDa) differs significantly from the calculated weight (34.2 kDa) , suggesting post-translational modifications that may affect functional studies.

How can antibodies against OR4F5 be validated for research applications?

Thorough validation of OR4F5 antibodies is critical to ensure experimental reliability and reproducibility:

Validation ApproachMethodologyConsiderations for OR4F5
Multiple Technique ValidationTest across WB, ELISA, IHC, ICCBoster validates antibodies across multiple applications
Positive/Negative ControlsUse tissues/cells with known OR4F5 expressionHuman, mouse, and rat samples can serve as positive controls
Blocking Peptide TestsPre-incubate antibody with immunizing peptideSignal should be significantly reduced or eliminated
Immunogen Sequence VerificationCheck that immunizing peptide (amino acids 51-100 of human OR4F5/4F4/4F17) is uniquePerform BLAST analysis to identify potential cross-reactivity
Molecular Weight ConfirmationVerify detected band appears at expected weightFor OR4F5, observed at ~72 kDa vs. calculated 34.2 kDa
Cross-Reactivity AssessmentTest specificity across related receptorsNote that some antibodies (e.g., Boster A30873) target OR4F4/4F5/4F17

Special consideration should be given to the potential cross-reactivity between OR4F5 and closely related family members OR4F4 and OR4F17, as commercial antibodies may recognize all three proteins . This cross-reactivity may be advantageous or problematic depending on your specific research question.

What are the challenges in expressing recombinant olfactory receptors in heterologous systems?

Expressing functional olfactory receptors, including OR4F5, in heterologous systems presents several challenges that researchers must address:

ChallengeDescriptionPotential Solutions
Poor Cell Surface ExpressionReceptors often accumulate in the endoplasmic reticulumUse specialized expression vectors with N-terminal fusion tags; co-express with receptor transporting proteins (RTPs)
G Protein Coupling IssuesOR4F5 naturally couples to Golf in olfactory neuronsCo-express with chimeric G proteins (e.g., Gα15/16)
Post-Translational Modification DifferencesHeterologous systems may not recapitulate native modificationsMay explain the discrepancy between calculated (34.2 kDa) and observed (72 kDa) weights
Protein StabilityORs are unstable when extracted from native membraneUse optimized buffer with stabilizing agents; recombinant OR4F5 is provided in Tris buffer with 50% glycerol
Functional Assay DevelopmentDetecting receptor activation requires appropriate readoutImplement calcium imaging, cAMP assays, or BRET approaches

Understanding and addressing these challenges is crucial for successful functional expression and characterization of OR4F5. Optimization strategies include codon optimization for the host system, lower incubation temperature (30-32°C) during expression, and co-expression with accessory proteins that facilitate proper folding and trafficking.

How can OR4F5 expression be analyzed in gene expression datasets?

Analyzing OR4F5 expression in gene expression datasets requires specific bioinformatic approaches:

Analysis StepMethodologyTools and Considerations
Data Extraction and ProcessingExtract gene expression data from repositoriesUtilize platforms like easyGEO to process data from NCBI GEO
NormalizationAccount for technical variablesApply CPM, FPKM, or TPM normalization for RNA-seq data
Differential Expression AnalysisCompare OR4F5 expression between conditionsUse DESeq2, edgeR, or limma; set thresholds (e.g., adj. p-value < 0.05, |logFC| ≥ 1)
VisualizationGenerate visual representationsCreate heatmaps, volcano plots, violin/box plots to show expression patterns

Example of data structure for OR4F5 expression analysis:

Gene/SampleSeries1_NHBE_MOCK_1Series1_NHBE_MOCK_2Series1_NHBE_MOCK_3
OR4F5000

This example from easyGEO documentation shows OR4F5 expression values across three control samples . In a complete analysis, this would be compared with expression in experimental conditions to identify significant changes.

For more complex analyses, consider co-expression patterns with other genes and integration with genomic data, including potential genetic variants from resources like NCBI's Variation Viewer that may affect OR4F5 expression .

What methodologies are appropriate for studying OR4F5 ligand binding and specificity?

Although the specific odorant ligands for OR4F5 are not identified in the provided search results, several methodological approaches can be used to identify and characterize ligand binding:

MethodologyDescriptionTechnical Considerations
High-Throughput ScreeningTest odorant libraries against cells expressing OR4F5Monitor activation via calcium imaging, cAMP assays, or reporter systems
Structure-Based Virtual ScreeningGenerate homology models for in silico dockingLeverage the known amino acid sequence of OR4F5
Competitive Binding AssaysUse labeled known ligands to measure displacementRequires at least one identified ligand as reference
Dose-Response AnalysisTest sequential dilutions of candidatesCalculate EC50 values to determine potency
Mutagenesis StudiesAlter predicted binding pocket residuesBased on OR4F5 sequence , identify key residues involved in ligand recognition

When performing these analyses, researchers should consider:

  • The need for functional expression systems that maintain OR4F5's native conformation

  • Potential differences in ligand specificity between recombinant systems and native olfactory neurons

  • The importance of validating hits using multiple orthogonal methods

  • The hydrophobic nature of many odorant molecules, which may present solubility challenges in aqueous assay systems

For publication-quality results, include appropriate positive and negative controls and demonstrate concentration-dependent responses to putative ligands.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.