Recombinant Human Olfactory receptor 4F6 (OR4F6)

Shipped with Ice Packs
In Stock

Description

Introduction to Olfactory Receptors and OR4F6

Olfactory receptors (ORs) constitute the largest gene superfamily in mammals, with humans possessing hundreds of functional OR genes. These receptors are primarily expressed in the cilia of olfactory sensory neurons where they interact with various odor molecules . The remarkable feature of OR expression is that each olfactory neuron typically expresses only a single OR allele, a phenomenon described as the "one receptor, one neuron" rule .

OR4F6, also known as olfactory receptor OR15-15, is a specific member of this extensive family. As a G protein-coupled receptor (GPCR), it features the characteristic seven-transmembrane domain structure common to this receptor class . The gene encoding human OR4F6 produces a 312 amino acid multi-pass membrane protein that functions as an odorant receptor, capable of binding odor molecules and initiating signal transduction .

Historical Context and Discovery

The discovery of olfactory receptors represented a significant breakthrough in understanding sensory perception. Building on this foundation, researchers have expanded their investigations to specific receptors like OR4F6. The development of recombinant protein technology has been instrumental in advancing this field, enabling the production and study of these typically difficult-to-isolate membrane proteins.

Significance in Olfactory Research

OR4F6 serves as an important model for understanding the broader mechanisms of olfactory perception. Recent research has demonstrated that olfactory receptors are not exclusively expressed in nasal tissues but can also be found in various other tissues throughout the body, suggesting potential non-olfactory functions . This expanded understanding of OR expression patterns has opened new avenues for research into their roles in health and disease.

Protein Structure

OR4F6 belongs to the superfamily of G protein-coupled receptors (GPCRs), characterized by their seven-transmembrane domain architecture. While the specific three-dimensional structure of human OR4F6 has not been fully elucidated in the provided search results, insights can be drawn from recent breakthroughs in the field. For instance, the structure of another human olfactory receptor, OR51E2, was recently determined, representing a landmark achievement in olfactory receptor research .

Like other olfactory receptors, OR4F6 is presumed to have an extracellular N-terminus, seven transmembrane α-helices, and an intracellular C-terminus. The binding pocket for odorants is typically formed by the transmembrane domains, creating a specific microenvironment that determines odorant specificity.

Role in Olfactory Sensation

OR4F6, like other olfactory receptors, plays a fundamental role in the initial steps of odor perception. These receptors are localized to the cilia of olfactory sensory neurons where they bind to odor molecules with varying degrees of specificity . The binding event triggers a signal transduction cascade that ultimately leads to the perception of smell.

Signal Transduction Pathway

When an odorant binds to OR4F6, it initiates a G protein-mediated signaling cascade. This process involves:

  1. Odorant binding to the receptor

  2. Activation of olfactory-specific G proteins

  3. Stimulation of adenylate cyclase, leading to increased cAMP production

  4. Opening of cyclic nucleotide-gated channels

  5. Membrane depolarization

  6. Generation of action potentials

  7. Signal transmission to the brain's primary olfactory cortex

This cascade transforms the chemical information of odorants into electrical signals that the brain can interpret as distinct smells.

Expression Systems

Recombinant production of olfactory receptors, including OR4F6, presents significant challenges due to their hydrophobic nature and complex folding requirements. Various expression systems have been employed for OR production, including:

  1. Mammalian cell lines (particularly modified lines like Hana3A that express chaperon proteins)

  2. Yeast

  3. Insect cells

  4. Cell-free systems

The Hana3A cell line, which expresses chaperon proteins like RTP1 or RTP2, olfactory G-protein, and rho tag, is commonly used for luciferase assays of olfactory receptors, accounting for approximately 41% of bioassay results in the M2OR database .

Purification and Stabilization

The purification of recombinant olfactory receptors typically involves affinity chromatography, facilitated by tags such as His-tags. Stabilization often requires specific detergents or lipid environments to maintain the native conformation of these membrane proteins.

For analogous products like Recombinant Rhesus monkey OR4F6 Protein, the following specifications have been reported:

AttributeSpecification
SourceMammalian Cells
TagHis
Endotoxin< 1.0 EU per μg (LAL method)
Purity>80%
Storage BufferPBS buffer
Storage Conditions+4°C (short term); -20°C to -80°C (long term)

These parameters might provide insights into the production and handling of the human counterpart .

Challenges in Structure Studies

Olfactory receptors, including OR4F6, are notoriously difficult to produce in quantities sufficient for structural studies. This challenge was highlighted in the recent landmark study of OR51E2, where researchers selected this particular receptor because it exhibits atypical stability due to its expression outside the nose in tissues like the kidney and gut . Similar considerations might apply to strategies for studying OR4F6.

Olfactory Research

Recombinant OR4F6 serves as a valuable tool for understanding the molecular basis of olfaction. By studying isolated receptors, researchers can investigate:

  1. Odorant binding specificity

  2. Structure-function relationships

  3. Receptor activation mechanisms

  4. Signal transduction pathways

Biomedical Applications

Beyond its role in olfaction, emerging research suggests potential applications for OR4F6 in biomedical contexts:

  1. Cancer Research: Olfactory receptors have been found to be expressed in and function in different types of cancers. Knockdown of certain ORs has been shown to significantly reduce cell proliferation, suggesting a role in carcinogenesis .

  2. Diagnostic Tools: The specific expression patterns of ORs in certain tissues might be leveraged for diagnostic purposes.

  3. Drug Discovery: Understanding the structure and binding properties of OR4F6 could potentially inform the development of drugs targeting this or related receptors.

Database Integration and Computational Studies

Databases like M2OR, which catalog olfactory receptor-odorant pairs, represent important resources for computational studies of ORs including OR4F6 . These databases facilitate:

  1. Virtual screening of potential ligands

  2. Structure-based modeling and docking studies

  3. Comparative analyses across species and receptor subtypes

The integration of experimental data on OR4F6 into such resources enhances the collective understanding of olfactory receptor biology.

Epigenetic Regulation

The expression of olfactory receptors, potentially including OR4F6, is subject to epigenetic regulation. Research has identified key regulators such as G9a (a histone methyltransferase) and LSD1 (lysine-specific demethylase 1A) that influence OR expression through the methylation and demethylation of H3K9me2 .

During cellular differentiation, the H3K9me2 levels of several OR promoters have been observed to decrease, regulated by G9a and LSD1, resulting in changes in OR transcription . This epigenetic regulation appears to play a critical role in determining when and where ORs are expressed.

Expression Patterns

While olfactory receptors were traditionally thought to be exclusively expressed in olfactory sensory neurons, emerging evidence suggests broader expression patterns:

  1. Olfactory Epithelium: Primary site of expression for most ORs

  2. Non-olfactory Tissues: Some ORs, potentially including OR4F6, may be expressed in tissues outside the olfactory system

  3. Cancer Cells: Aberrant expression has been observed in various cancer types

The specific expression pattern of OR4F6 across human tissues was not explicitly detailed in the provided search results.

Cross-Species Comparison

The OR4F6 gene has been identified in multiple species, including humans, chimpanzees (Pan troglodytes), and rhesus macaques (Macaca mulatta) . Comparative analysis of OR4F6 across species can provide insights into:

  1. Evolutionary conservation and divergence

  2. Species-specific adaptations in olfactory function

  3. Structural determinants of receptor specificity

In rhesus macaques, OR4F6 (also known as olfactory receptor 4F6 or olfactory receptor OR15-15) has been characterized, with recombinant versions being commercially available for research purposes .

Comparison with Other Olfactory Receptors

OR4F6 is one member of the extensive olfactory receptor family. Comparative analysis with other characterized ORs, such as the recently structurally elucidated OR51E2, can provide valuable insights into common principles and receptor-specific features .

The OR51E2 structure revealed how this receptor interacts with propionate, the compound responsible for the pungent smell of Swiss cheese . Similar structural studies of OR4F6 would significantly advance the understanding of its specific odorant preferences and binding mechanisms.

Functional Genomics Approaches

Advanced genomic techniques offer opportunities to further investigate OR4F6:

  1. CRISPR-Cas9 gene editing to study receptor function in cellular and animal models

  2. Single-cell RNA sequencing to map expression patterns with unprecedented resolution

  3. High-throughput screening to identify specific ligands and modulators

Therapeutic Potential

Understanding OR4F6 structure and function could potentially inform therapeutic strategies:

  1. Cancer Therapeutics: Given the observed role of ORs in cell proliferation , OR4F6 might represent a novel target in certain cancer types

  2. Olfactory Disorders: Insights into OR4F6 function could contribute to developing treatments for olfactory dysfunction

  3. Drug Delivery: OR-based targeting strategies might enhance the specificity of drug delivery systems

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please specify it. We will prioritize developing the designated tag if possible.
Synonyms
OR4F6; OR4F12; Olfactory receptor 4F6; Olfactory receptor 4F12; Olfactory receptor OR15-15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR4F6
Target Protein Sequence
MDEANHSVVSEFVFLGLSDSRKIQLLLFLFFSVFYVSSLMGNLLIVLTVTSDPRLQSPMY FLLANLSIINLVFCSSTAPKMIYDLFRKHKTISFGGCVVQIFFIHAVGGTEMVLLIAMAF DRYVAICKPLHYLTIMNPQRCILFLVISWIIGIIHSVIQLAFVVDLLFCGPNELDSFFCD LPRFIKLACIETYTLGFMVTANSGFISLASFLILIISYIFILVTVQKKSSGGIFKAFSML SAHVIVVVLVFGPLIFFYIFPFPTSHLDKFLAIFDAVITPVLNPVIYTFRNKEMMVAMRR RCSQFVNYSKIF
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15372

KEGG: hsa:390648

STRING: 9606.ENSP00000327525

UniGene: Hs.553399

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for recombinant OR4F6 studies?

For optimal expression of recombinant OR4F6, Hana3A cell lines have proven most effective among heterologous expression systems. These cells express necessary chaperon proteins like RTP1 and RTP2, along with olfactory G-proteins and rho tag, which significantly enhance functional expression of olfactory receptors . When designing your expression system:

  • Ensure the inclusion of RTP1/RTP2 and REEP1 accessory proteins to improve membrane trafficking

  • Incorporate Gαolf subunit for proper signal transduction

  • Consider using rho-tag modifications at the N-terminus to enhance surface expression

  • Validate expression through immunocytochemistry or western blotting before functional assays

Alternative systems include HEK293T cells, though these typically show lower expression efficiency unless supplemented with accessory proteins. Importantly, assay-dependent bias has been observed across different cell lines; receptors identified in prostate carcinoma cell lines (LNCaP) were not recognized when expressed in HEK293 cells .

How can I determine optimal concentrations for OR4F6 ligand screening experiments?

When screening potential ligands for OR4F6, it's crucial to test across a wide concentration range due to the concentration-dependent nature of olfactory perception. The M2OR database highlights that:

  • Low concentrations may yield no cellular response

  • Higher concentrations can convert non-ligands to agonists for multiple ORs

Recommended concentration design for screening:

  • Initial broad screening: 10-100 μM

  • Detailed characterization: Generate full dose-response curves (0.1-1000 μM)

  • EC50 determination: Test at minimum 6-8 concentrations spanning expected activation range

Remember that concentration influences not only receptor activation but can fundamentally alter perceived odor quality and hedonicity . Document both screening concentrations and EC50 values for all experiments to enable comparison with other studies.

What are the key challenges in expressing functional OR4F6 for structural studies?

Structural studies of OR4F6 face several significant challenges:

  • Low expression levels typical of olfactory receptors

  • Structural heterogeneity and dynamic conformational changes

  • Inherent instability of purified OR proteins

  • Low solubility of volatile odorants

Researchers successfully studying OR51E2 overcame these hurdles by selecting a receptor expressed in both olfactory and non-olfactory tissues, making it more amenable to heterologous expression . To improve OR4F6 expression yields:

  • Optimize codon usage for your expression system

  • Use fusion partners (T4 lysozyme, thermostabilized apocytochrome b562) to enhance stability

  • Consider nanobody co-expression to stabilize specific conformations

  • Implement systematic mutagenesis to identify stabilizing mutations

  • Explore detergent screening to identify optimal solubilization conditions

How can I differentiate between specific and non-specific binding in OR4F6 ligand assays?

To distinguish specific from non-specific binding when analyzing OR4F6-ligand interactions:

  • Include proper negative controls:

    • Mock-transfected cells lacking OR4F6

    • Cells expressing unrelated ORs (OR5K1, OR5M3, or OR8D1)

    • Test known ligands that activate other receptors but not OR4F6

  • Perform competition assays:

    • Pre-incubate with unlabeled ligand before adding labeled compound

    • Test structurally related and unrelated competitors

    • Generate competition curves to calculate binding affinities

  • Utilize mutagenesis studies:

    • Create point mutations in predicted binding pocket residues

    • Analyze how specific residue changes affect ligand binding

    • Differentiate between effect on binding versus downstream signaling

  • Compare responses across multiple assay types:

    • Luciferase reporter assays

    • cAMP accumulation measurements

    • Calcium imaging

    • GTP-γS binding assays

This multi-faceted approach helps overcome the challenge of non-specific activation, especially at higher ligand concentrations.

How can I use AlphaFold2 and molecular dynamics to study OR4F6 structure?

AlphaFold2 combined with molecular dynamics (MD) simulations provides powerful tools for predicting and analyzing OR4F6 structure, particularly when experimental structures are unavailable:

  • Initial structure prediction:

    • Use AlphaFold2 to generate baseline OR4F6 structure

    • Assess prediction confidence through PAE (predicted aligned error) metrics

    • Compare outputs with known OR structures, particularly OR51E2

  • Structural refinement through MD:

    • Embed predicted structure in lipid bilayer mimicking olfactory sensory neuron membrane

    • Add explicit solvent and ions to physiological concentration

    • Perform equilibration followed by production simulations (typically 100-300 ns)

    • Analyze conformational stability and binding pocket dynamics

  • State transition exploration:

    • MD can overcome AlphaFold2's limitation of predicting single states

    • Model both active and inactive conformations of OR4F6

    • Capture structural transformations during activation/deactivation

  • Binding site characterization:

    • Identify key residues forming the binding pocket

    • Analyze pocket volume and electrostatic properties

    • Compare with other deorphaned receptors to identify common features

Recent structural studies of OR51E2 revealed that binding pocket volume critically determines ligand selectivity, with its 31 ų pocket accommodating only short-chain fatty acids . Similar analysis of OR4F6 can provide insights into its ligand specificity.

What is the role of extracellular loops in OR4F6 ligand recognition?

Extracellular loops (ECLs) play crucial roles in olfactory receptor function, with recent research highlighting their importance in OR4F6 and other ORs:

  • ECL2 functions:

    • Shapes and regulates binding pocket volume

    • Maintains hydrophobic properties of the pocket

    • Acts as gatekeeper for odorant access to binding site

  • ECL3 involvement:

    • Undergoes structural alterations upon odorant binding

    • Transmits conformational changes to transmembrane domains

    • Contributes to receptor activation

For studying ECL roles in OR4F6:

  • Perform alanine scanning mutagenesis across ECL regions

  • Create chimeric receptors with ECLs swapped between OR4F6 and related receptors

  • Utilize molecular dynamics to monitor ECL dynamics during ligand approach and binding

  • Employ site-directed crosslinking to identify dynamic interactions between ECLs and ligands

The structural alterations in ECL3 induced by propionate binding to OR51E2 provide a template for understanding similar mechanisms in OR4F6 .

How can I predict the binding mechanism between OR4F6 and potential ligands?

To predict OR4F6-ligand binding mechanisms:

  • Molecular docking approach:

    • Generate an ensemble of OR4F6 conformations through MD

    • Prepare ligand library with proper stereochemistry (critical for accurate predictions)

    • Perform flexible docking focusing on binding pocket identified through homology with known structures

    • Rank ligands based on binding scores and interaction patterns

  • Binding mode analysis:

    • Examine key interaction types:

      • Hydrogen bonding

      • π-π stacking (particularly important for aromatic compounds)

      • Hydrophobic interactions

      • Ionic bonds

    • Focus on interactions with transmembrane regions TM3, TM5, and TM6, which are frequently involved in odorant binding

  • Validation approaches:

    • Identify conserved binding residues across OR family

    • Perform site-directed mutagenesis of predicted contact residues

    • Compare with known ligand-receptor pairs in M2OR database

    • Test structure-activity relationships with chemically related compounds

Interaction TypeCommon ResiduesDetection MethodSignificance in OR Binding
Hydrogen bondingSer, Thr, Asn, TyrMD simulation, mutagenesisCritical for polar odorants
π-π stackingPhe, Tyr, TrpDistance measurements in MDStabilizes aromatic compounds
HydrophobicVal, Leu, Ile, PheBinding energy decompositionPrimary interaction for most odorants
IonicAsp, Glu, Lys, ArgElectrostatic potential mappingImportant for charged odorants

What high-throughput screening approaches are most effective for identifying OR4F6 ligands?

For efficient deorphanization of OR4F6, consider these validated high-throughput screening approaches:

  • Dual-screening strategy:

    • Test diverse food odorant molecules against OR4F6

    • Counter-screen: test promising compounds against the complete human OR repertoire

    • This approach successfully identified 14 novel agonists for OR1A1 and 18 for OR2W1

  • Luciferase-based reporter assays:

    • Most widely used (41% of bioassays in M2OR database)

    • Utilize Hana3A cells expressing accessory proteins

    • Incorporate cAMP-responsive elements driving luciferase expression

    • Provides quantitative dose-dependent activation profiles

  • Fluorescence-based calcium imaging:

    • Allows real-time monitoring of receptor activation

    • Permits screening of multiple compounds in sequence

    • Enables single-cell resolution analysis

    • Can identify responses with different kinetic profiles

  • Computational pre-screening:

    • Molecular field-based similarity analysis to identify candidates

    • Pharmacophore modeling based on known ligands of related ORs

    • This approach identified 4-hydroxy-5-methylfuran-3(2H)-one and methylglyoxal as ligands for OR1G1 and OR52H1

Document all experimental parameters, including screening concentration, cell line, and assay type, as these critically affect outcomes and reproducibility .

How can I address contradictory results from different OR4F6 functional assays?

Contradictory results between different functional assays are common in OR research due to assay-dependent bias . To resolve such contradictions:

  • Systematically compare assay conditions:

    • Cell line differences (HEK293 vs. Hana3A vs. LNCaP)

    • Expression level variations

    • Signal amplification differences between assay types

    • Receptor trafficking efficiency variations

  • Perform cross-validation using multiple assay types:

    • Luciferase reporter assays

    • HTRF-based cAMP detection

    • Calcium imaging

    • Electrophysiology (patch-clamp)

    • BRET-based G protein coupling assays

  • Consider concentration effects:

    • Test identical concentration ranges across all assay platforms

    • Document EC50 values from each assay type

    • Evaluate if discrepancies occur at specific concentration ranges

  • Assess receptor functionality:

    • Confirm surface expression through immunocytochemistry

    • Use positive control ligands when available

    • Evaluate response to known broadly-activating odorants

  • Create an assay confidence scoring system similar to those used in machine learning applications , weighting results based on:

    • Assay reproducibility

    • Signal-to-noise ratio

    • Dose-dependence characteristics

    • Correlation with structurally similar compounds

What strategies help prioritize chemical classes for OR4F6 ligand screening?

To efficiently identify potential OR4F6 ligands, prioritize chemical classes using these strategies:

  • Phylogenetic relationship analysis:

    • Identify OR4F6's closest related receptors with known ligands

    • Focus on chemical scaffolds recognized by phylogenetically related ORs

    • Consider evolutionary conservation patterns of binding pocket residues

  • Binding pocket analysis:

    • Estimate OR4F6 binding pocket volume (similar to the 31 ų pocket of OR51E2)

    • Match potential ligands to compatible molecular size

    • Analyze electrostatic and hydrophobic properties to predict compatible chemical classes

  • Focused chemical class screening based on OR family patterns:

    • Short-chain fatty acids (successful for OR51E2)

    • Pyrazine compounds (recognized by OR5K1)

    • Furanones (recognized by OR5M3 and OR8D1)

    • Phenolic compounds (recognized by OR9Q2)

  • Activity pattern comparison:

    • Screen a small diverse set (~50 compounds)

    • Compare activation pattern with known "response spectra" of characterized ORs

    • Use pattern similarity to guide expanded screening

This strategic approach can significantly reduce the chemical space needed for screening from thousands to hundreds of compounds, making deorphanization more efficient.

How should I analyze dose-response data from OR4F6 activation experiments?

Proper analysis of OR4F6 dose-response data is essential for accurate ligand characterization:

  • Data normalization approaches:

    • Normalize to maximum response of a reference agonist

    • Use fold-change over baseline for each compound

    • Include positive controls in each experiment plate

  • Curve fitting recommendations:

    • Apply four-parameter logistic regression

    • Extract key parameters:

      • EC50 (half-maximal effective concentration)

      • Emax (maximum efficacy)

      • Hill slope (cooperativity coefficient)

      • Basal activity (without ligand)

  • Statistical considerations:

    • Perform experiments with at least 3-5 biological replicates

    • Include technical triplicates for each concentration

    • Calculate 95% confidence intervals for all parameters

    • Use appropriate statistical tests for comparing ligand potencies

  • Advanced analyses:

    • Operational model fitting to distinguish affinity from efficacy

    • Bias factor calculation if multiple signaling pathways are measured

    • Kinetic analyses if real-time data is available

For meaningful comparisons with literature data, document precise experimental conditions as demonstrated in the M2OR database, including cell line, assay type, and concentration ranges .

What are the best practices for investigating OR4F6 signal transduction pathways?

To thoroughly characterize OR4F6 signal transduction:

  • G protein coupling profile determination:

    • Test coupling to multiple G protein subtypes (Gαolf/Gαs, Gαi, Gαq)

    • Use BRET-based sensors for direct coupling measurement

    • Compare with canonical Gαolf coupling typical of olfactory receptors

  • Second messenger cascade analysis:

    • cAMP production (via HTRF, BRET, or FRET-based sensors)

    • Calcium mobilization (via fluorescent indicators)

    • IP3 generation (for potential Gαq coupling)

  • Receptor desensitization mechanisms:

    • β-arrestin recruitment assessment

    • Receptor internalization kinetics

    • Phosphorylation status analysis

  • Comparison with other characterized ORs:

    • Signal amplification differences

    • Temporal response profiles

    • Ligand-specific pathway bias

Understanding these pathways is crucial for interpreting differences between assay systems and explaining apparently contradictory results from different experimental platforms .

How can I integrate OR4F6 research into broader olfactory coding studies?

To position OR4F6 research within the broader olfactory code:

  • Combinatorial response mapping:

    • Test OR4F6 against odorant panels used for other characterized ORs

    • Position OR4F6 within the receptor activation matrix

    • Identify unique vs. overlapping response profiles

  • Structure-function relationship analysis:

    • Compare OR4F6 binding pocket with other ORs

    • Identify conserved vs. variable regions determining ligand specificity

    • Document how minor alterations in receptor functionality translate to perceptual consequences

  • Data integration with existing databases:

    • Submit OR4F6 experimental data to M2OR database

    • Include comprehensive metadata about experimental conditions

    • Document both responsive and non-responsive ligand pairs

  • Contribution to computational models:

    • Use OR4F6 data to train or validate machine learning models

    • Incorporate response data into olfactory coding prediction frameworks

    • Document confidence levels for experimental data as recommended for machine learning applications

This integration helps address the fundamental challenge of understanding how a relatively small number of receptors enable discrimination of thousands of odors .

What methods can elucidate structural changes in OR4F6 during activation?

To investigate structural dynamics during OR4F6 activation:

  • Cryo-electron microscopy approaches:

    • Stabilize OR4F6 in active and inactive conformations

    • Use nanobodies or G protein mimetics to capture active state

    • Compare with the pioneering cryo-EM structure of OR51E2

  • Molecular dynamics simulation strategies:

    • Simulate ligand binding and unbinding pathways

    • Monitor conformational changes in key regions:

      • Transmembrane helices (particularly TM3, TM5, TM6)

      • Extracellular loop dynamics (especially ECL2 and ECL3)

      • Intracellular G protein coupling interface

    • Identify key interaction networks stabilizing active vs. inactive states

  • Site-directed fluorescence labeling:

    • Introduce fluorescent probes at strategic positions

    • Monitor conformational changes via FRET or fluorescence quenching

    • Track real-time structural rearrangements during activation

  • Hydrogen-deuterium exchange mass spectrometry:

    • Map regions undergoing structural rearrangement

    • Compare ligand-bound vs. unbound states

    • Identify differential solvent exposure patterns

These approaches can reveal whether OR4F6 follows the activation mechanism observed with OR51E2, where structural alterations in ECL3 trigger receptor activation .

How can I investigate potential extranasal functions of OR4F6?

Olfactory receptors like OR4F6 can have important functions beyond the olfactory system:

  • Expression profiling approaches:

    • RT-qPCR across tissue panel

    • RNA-seq data mining from public databases

    • Single-cell transcriptomics analysis

    • Protein detection via immunohistochemistry

  • Functional characterization in non-olfactory tissues:

    • Cell-specific knockout or knockdown

    • Physiological response measurement in target tissues

    • Ectopic expression systems to confirm functionality

  • Specialized experimental designs:

    • For potential prostate expression (similar to OR51E2) :

      • Test effects on prostate cancer cell proliferation

      • Analyze hormone responsiveness

      • Investigate signaling pathways in prostate cell lines

  • Clinical correlation studies:

    • Analyze expression in pathological vs. normal tissues

    • Examine genetic variants and association with disease

    • Investigate potential as diagnostic or therapeutic target

This approach is supported by OR51E2 research, which revealed important functions in both olfactory neurons and prostate tissue .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.