Recombinant Human Olfactory receptor 4K14 (OR4K14)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

Recombinant OR4K14 is produced using heterologous expression systems to enable functional studies:

Key Production Parameters

ParameterDetails
Host SystemsE. coli, yeast, baculovirus, or mammalian cells
TagsN-terminal His tag or FLAG/rho1D4 epitopes for purification
Purity≥85% (SDS-PAGE analysis)
Storage ConditionsLyophilized or liquid at -20°C/-80°C; avoid repeated freeze-thaw cycles
Yield~1.6 mg (monomer) and ~1.1 mg (dimer) from 60 T175 flasks (analogous systems)

Functional validation often involves cAMP assays or intrinsic tryptophan fluorescence to confirm ligand-binding activity .

Research Applications

OR4K14 is utilized in diverse experimental workflows:

Experimental Use Cases

ApplicationMethodologyCitation
Ligand ScreeningFluorescence-based binding assays with odorants
Structural StudiesCircular dichroism (CD) for folding analysis
Cellular SignalingReal-time cAMP assays in HEK293 cells
ImmunodetectionWestern blot (WB) and immunofluorescence (IF) using polyclonal antibodies

Challenges and Recent Advances

  1. Ligand Identification: OR4K14 remains an orphan receptor with no confirmed natural ligands . High-throughput screening using heterologous systems is ongoing .

  2. Structural Resolution: No crystal structures exist; homology modeling relies on GPCR templates .

  3. Assay Variability: Functional responses may differ across expression systems (e.g., HEK293 vs. LNCaP cells) .

Future Directions

  • Deorphanization: Large-scale odorant screens using M2OR database frameworks .

  • Therapeutic Potential: Exploration in non-olfactory tissues (e.g., prostate) .

  • Biophysical Studies: Cryo-EM or NMR for structure-function insights .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us. We will prioritize the development of your specified tag.
Synonyms
OR4K14; Olfactory receptor 4K14; Olfactory receptor OR14-22
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR4K14
Target Protein Sequence
MDPQNYSLVSEFVLHGLCTSRHLQNFFFIFFFGVYVAIMLGNLLILVTVISDPCLHSSPM YFLLGNLAFLDMWLASFATPKMIRDFLSDQKLISFGGCMAQIFFLHFTGGAEMVLLVSMA YDRYVAICKPLHYMTLMSWQTCIRLVLASWVVGFVHSISQVAFTVNLPYCGPNEVDSFFC DLPLVIKLACMDTYVLGIIMISDSGLLSLSCFLLLLISYTVILLAIRQRAAGSTSKALST CSAHIMVVTLFFGPCIFVYVRPFSRFSVDKLLSVFYTIFTPLLNPIIYTLRNEEMKAAMK KLQNRRVTFQ
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15352

KEGG: hsa:122740

STRING: 9606.ENSP00000305011

UniGene: Hs.626814

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR4K14 and what is its functional role in the human olfactory system?

OR4K14 (Olfactory receptor 4K14) is a G-protein-coupled receptor (GPCR) that belongs to the largest gene family in the human genome. Olfactory receptors interact with odorant molecules in the nose to initiate neuronal responses that trigger smell perception. OR4K14 recognizes specific odorant molecules and mediates G protein-coupled signal transduction, contributing to our ability to discriminate between thousands of different odors .

The olfactory system operates on a combinatorial code principle - a single odorant can activate multiple receptors, and each receptor can respond to several different molecules. This complex coding system enables humans to detect and discriminate a vast array of odors despite having a relatively limited number of receptors .

How are recombinant forms of OR4K14 typically produced for research use?

Recombinant OR4K14 can be produced using several expression systems:

  • E. coli system: Used for producing full-length human OR4K14 with His-tag, typically at the N-terminus. This system can achieve high yields but may have limitations for proper folding of complex membrane proteins .

  • Wheat germ cell-free system: Used to produce full-length OR4K14 with GST-tag at the N-terminal. This approach can be advantageous for producing membrane proteins that might be toxic to living cells .

  • Mammalian expression systems: Systems using HEK293 or Hana3A cells (which express chaperone proteins like RTP1/RTP2) are preferred for functional studies as they provide better folding and post-translational modifications .

Commercial recombinant OR4K14 proteins are available in lyophilized powder form and require reconstitution in appropriate buffers before use .

What are the essential controls for experiments involving recombinant OR4K14?

When designing experiments with recombinant OR4K14, the following controls are critical:

  • Positive controls: Include known ligands for OR4K14 or related olfactory receptors with confirmed activity.

  • Negative controls: Use vehicle controls (solvent without ligand) and cells expressing an unrelated receptor or non-transfected cells.

  • Expression verification: Include controls to verify successful expression of the recombinant OR4K14, such as Western blotting with anti-OR4K14 or anti-tag antibodies .

  • Concentration controls: Test multiple ligand concentrations, as odorant concentration significantly influences OR response .

  • Stereochemical controls: When testing potential ligands, consider stereoisomers as certain ORs show differential responses to enantiomers .

Based on experimental design principles for biological research, studies should incorporate randomization, technical and biological replicates, and appropriate statistical analyses to ensure validity and reliability .

How should researchers design a study to characterize OR4K14 ligand binding?

A comprehensive experimental design for characterizing OR4K14 ligand binding should include:

  • Study design selection: Use a factorial design to test multiple variables simultaneously, such as ligand type, concentration, and experimental conditions .

  • Cell line selection: Preferably use Hana3A cells which express accessory proteins (RTP1, RTP2) that enhance receptor trafficking and function .

  • Assay methodology: Implement luciferase reporter assays (the most common method accounting for 41% of bioassays in OR research) .

  • Quantitative readout: Design the experiment to generate dose-response curves and determine EC50 values for potential ligands.

  • Time-series measurements: Consider the temporal dynamics of receptor activation and desensitization .

  • Statistical analysis plan: Pre-determine appropriate statistical tests and sample sizes needed for adequate power .

  • Documentation of methods: Follow the rubric for experimental design (RED) that includes sections on variables, measures, variability control, and scope of inference .

This experimental design should yield data suitable for both graphical representation (dose-response curves) and statistical analysis to determine ligand specificity and potency.

What are the common pitfalls in OR4K14 research and how can they be avoided?

Researchers should be aware of these common pitfalls when studying OR4K14:

  • Expression system limitations: Different expression systems (E. coli, wheat germ, mammalian cells) produce proteins with varying functionality. The same OR can show different responses depending on the cell line used .

  • Concentration dependence: An odorant that shows no activity at low concentrations may become an agonist at higher concentrations, leading to false negatives if not tested across a concentration range .

  • Assay-dependent bias: Results can vary significantly based on the bioassay used. For example, ligands identified in one cell line (LNCaP) may not be recognized when the same receptor is expressed in another cell line (HEK293) .

  • Receptor trafficking issues: Without proper chaperone proteins (RTP1/RTP2), olfactory receptors often fail to traffic to the cell membrane, resulting in non-functional receptors despite successful expression .

  • Improper controls: Failing to include appropriate positive and negative controls can lead to misinterpretation of results .

  • Stereochemistry ignorance: Not accounting for the stereochemistry of test compounds can lead to inconsistent results, as some ORs respond differently to enantiomers .

To avoid these pitfalls, researchers should use multiple complementary approaches, test compounds at various concentrations, properly document all experimental conditions, and include essential controls in all experiments.

What functional assays are most effective for characterizing OR4K14 activity?

Several functional assays can effectively characterize OR4K14 activity:

  • Luciferase reporter assays: Most widely used method (41% of OR bioassays), where receptor activation is coupled to luciferase expression via cAMP-dependent signaling pathways .

  • Calcium imaging: Measures intracellular calcium flux upon receptor activation using fluorescent calcium indicators.

  • cAMP assays: Direct measurement of cAMP production using ELISA or other methods, as olfactory receptors typically signal through Golf to activate adenylyl cyclase.

  • Electrophysiological recordings: In cells expressing OR4K14, patch-clamp recordings can measure ionic currents triggered by receptor activation.

  • GTPγS binding assays: Direct measurement of G-protein activation following receptor stimulation.

The choice of assay should consider sensitivity requirements, equipment availability, and the specific research question. For high-throughput screening, luciferase reporter assays in 384-well format are most practical.

How can researchers optimize protein stability and solubility for recombinant OR4K14?

Optimizing stability and solubility of recombinant OR4K14 requires consideration of several factors:

  • Buffer composition: Use Tris/PBS-based buffers with pH 8.0, supplemented with stabilizing agents like 6% trehalose .

  • Storage conditions:

    • Long-term: Store at -20°C/-80°C in aliquots to avoid freeze-thaw cycles

    • Working solutions: Store at 4°C for up to one week

  • Reconstitution protocol: For lyophilized protein, reconstitute in deionized sterile water to 0.1-1.0 mg/mL, adding glycerol to a final concentration of 5-50% (recommended 50%) .

  • Membrane protein solubilization: As a 7-transmembrane protein, OR4K14 requires appropriate detergents or lipid environments to maintain native conformation.

  • Purification strategy: For His-tagged OR4K14, purification should achieve >90% purity as determined by SDS-PAGE .

A detailed protocol from commercial providers recommends briefly centrifuging the protein vial before opening and avoiding repeated freeze-thaw cycles .

What methods are available for studying OR4K14 in olfactory signaling pathways?

To investigate OR4K14's role in olfactory signaling pathways, researchers can employ:

  • Heterologous expression systems: Express OR4K14 in cell lines that allow for controlled study of signaling components.

  • Universal odor code systems: These encode olfactory stimuli as quantitative measures of responses by olfactory receptors, producing odor code profiles that can be mapped to specific stimuli .

  • Artificial arrays: Systems containing chambers with cells expressing olfactory receptors, including OR4K14, can be used to test receptor responses to various odorants .

  • Computational approaches: In silico methods can predict ligand binding and receptor activation based on structural models.

  • Receptor mutagenesis: Systematic mutation of specific residues can identify domains critical for ligand binding or G-protein coupling.

  • Combinatorial analysis: Study OR4K14 activation in the context of other ORs to understand its contribution to the combinatorial olfactory code .

These approaches can be combined to develop a comprehensive understanding of OR4K14's role in olfactory signal transduction.

How should researchers analyze and interpret data from OR4K14 binding studies?

Analysis and interpretation of OR4K14 binding data requires a systematic approach:

  • Data organization: Create well-formatted data tables with appropriate column headings, units, and measurement uncertainty . Example format:

Compound IDStructureConcentration (μM)OR4K14 Response (% Control)p-valueAssay Type
Compound 1[Structure]185 ± 50.003Luciferase
Compound 1[Structure]10142 ± 8<0.001Luciferase
Compound 2[Structure]112 ± 30.24Luciferase
  • Dose-response analysis: Fit dose-response curves to determine EC50 values and efficacy parameters.

  • Statistical testing: Apply appropriate statistical tests to determine significance of responses compared to controls .

  • Structure-activity relationship analysis: Compare responses across structurally related compounds to identify molecular features important for receptor activation.

  • Combinatorial coding analysis: Interpret OR4K14 responses in the context of other OR responses to the same compounds to understand combinatorial coding .

  • Database comparison: Compare results with existing OR-odorant interaction databases like M2OR, which contains information on OR-molecule experiments including non-responsive pairs .

The analysis should account for assay-dependent bias and consider both positive results (activation) and negative results (lack of response) as valuable data points .

What statistical approaches are appropriate for analyzing OR4K14 experimental data?

When analyzing OR4K14 experimental data, researchers should consider these statistical approaches:

  • Descriptive statistics: Calculate means, standard deviations, and standard errors of measurements.

  • Hypothesis testing: Use t-tests for simple comparisons and ANOVA for multiple comparisons.

  • Non-parametric tests: When data doesn't follow normal distribution, use Mann-Whitney U or Kruskal-Wallis tests.

  • Regression analysis: For dose-response relationships, use nonlinear regression to fit appropriate models (e.g., four-parameter logistic model).

  • Data normalization: Normalize data to positive controls to account for inter-assay variability.

  • Multiple testing correction: When testing many compounds, apply Bonferroni or false discovery rate corrections.

  • Principal component analysis: For complex datasets involving multiple ORs or compounds, use PCA to identify patterns.

Statistical significance should be set appropriately (typically p<0.05 for KEGG analysis and p<0.01 for GO enrichment analysis) , and researchers should report both statistical significance and effect size measures.

How can contradictory results in OR4K14 studies be reconciled and interpreted?

Contradictory results in OR4K14 studies may arise for several reasons. Researchers should take these steps to reconcile discrepancies:

  • Methodological differences: Compare experimental protocols including:

    • Expression systems used (E. coli, wheat germ, mammalian cells)

    • Assay types (luciferase, calcium imaging, cAMP measurement)

    • Cell lines (Hana3A vs. HEK293 vs. LNCaP)

  • Concentration effects: Examine concentration differences, as odorants may show activity only at specific concentrations .

  • Accessory protein variation: Check for presence/absence of chaperone proteins like RTP1/RTP2 that affect receptor trafficking and function.

  • Stereochemistry documentation: Verify whether studies properly documented stereochemistry of test compounds, as enantiomers may elicit different responses .

  • Meta-analysis approach: Systematically analyze multiple studies to identify patterns and sources of variation.

  • Replication studies: Design experiments that specifically address contradictions by testing multiple conditions simultaneously.

  • Receptor variants: Consider whether different studies used different genetic variants of OR4K14.

By carefully examining methodological details and experimental conditions, researchers can often explain apparently contradictory results and develop a more nuanced understanding of OR4K14 function.

How can OR4K14 be utilized in the development of biosensors for odorant detection?

OR4K14 can be incorporated into biosensor platforms through several approaches:

  • Cell-based biosensors: Engineer cells expressing OR4K14 coupled to reporter systems (fluorescent proteins, luciferase) that produce measurable signals upon receptor activation.

  • Cell-free systems: Incorporate purified OR4K14 into artificial membrane systems (liposomes, nanodiscs) coupled with detection methods such as surface plasmon resonance.

  • Field-effect transistor (FET) biosensors: Immobilize OR4K14 on the gate surface of FETs to detect ligand-induced conformational changes through electrical signals.

  • Artificial nose systems: Integrate OR4K14 alongside other olfactory receptors in sensor arrays that mimic the combinatorial coding of the natural olfactory system .

  • Universal odor code systems: Incorporate OR4K14 into systems that encode olfactory stimuli as quantitative measures of receptor responses, producing distinctive odor code profiles .

For effective biosensor development, researchers must address challenges including receptor stability in artificial environments, maintenance of functional conformation, and signal amplification for detecting low odorant concentrations.

What are the latest findings regarding OR4K14's role in diseases beyond olfactory disorders?

Recent research has revealed unexpected roles for OR4K14 beyond olfactory function:

  • Hashimoto's thyroiditis: OR4K14 was identified as one of 160 upregulated differentially expressed genes (DEGs) in Hashimoto's thyroiditis patients compared to healthy controls .

  • Signaling pathways: KEGG pathway analysis showed that OR4K14 and other DEGs were mainly related to olfactory transduction, suggesting previously unrecognized functions in thyroid tissue .

  • Potential biomarker: The upregulation of OR4K14 suggests its potential use as a biomarker for Hashimoto's thyroiditis development .

  • Gene ontology association: GO analysis associated OR4K14 with biological processes including "detection of chemical stimulus involved in sensory perception," revealing potential non-canonical functions .

What computational approaches can advance OR4K14 research?

Computational approaches offer powerful tools for advancing OR4K14 research:

  • Homology modeling: Generate 3D structural models of OR4K14 based on crystallized GPCRs to predict binding sites and conformational changes.

  • Molecular docking: Screen virtual compound libraries to identify potential ligands and predict binding modes.

  • Molecular dynamics simulations: Model dynamic interactions between OR4K14 and ligands to understand binding kinetics and conformational changes.

  • Machine learning algorithms: Train on existing OR-ligand interaction data from databases like M2OR to predict new potential ligands .

  • Network analysis: Map OR4K14 within the broader olfactory receptor network to understand its role in combinatorial coding.

  • Data visualization tools: Develop advanced visualization methods for complex OR interaction data, similar to the People Also Ask Query tool that visualizes relationships between questions .

  • Artificial intelligence approaches: Apply deep learning to predict OR4K14 responses to novel compounds based on structural similarities to known ligands.

These computational approaches can help prioritize experimental testing, generate testable hypotheses, and accelerate discovery of OR4K14 ligands and functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.