Recombinant Human Olfactory receptor 4N2 (OR4N2)

Shipped with Ice Packs
In Stock

Description

Introduction to Olfactory Receptors

Olfactory receptors constitute the primary molecular mechanism for odor detection in mammals. These G protein-coupled receptors are expressed in olfactory sensory neurons located in the nasal epithelium, where they interact with volatile odorant molecules. The discrimination of molecular signals in the olfactory system begins with the initial reception of odorants by these specialized neurons, followed by subsequent processing in the olfactory bulb and olfactory cortex . The molecular receptive range in olfactory neurons is determined by the structural information encoded within odorant molecules, including variations in chain length, terminal groups, and positions of functional groups . This complex system allows humans to detect and distinguish thousands of different odors with remarkable sensitivity and specificity.

Olfactory receptor genes represent the largest gene superfamily in humans, with hundreds of functional genes and pseudogenes distributed throughout the genome . These genes exhibit substantial genetic variation between individuals, contributing to differences in olfactory perception. The diversity and complexity of olfactory receptor genes reflect their evolutionary history and functional specialization, with evidence suggesting different selective pressures acting on various members of this gene family . Understanding the molecular characteristics and functional properties of specific olfactory receptors, such as OR4N2, provides valuable insights into the mechanisms of olfactory perception and the evolution of sensory systems.

Recombinant Expression Systems for Olfactory Receptors

One pioneering approach for recombinant expression of olfactory receptors involves adenovirus-mediated expression systems, as demonstrated in studies with other olfactory receptors such as MOR23 . In this methodology, recombinant adenovirus vectors containing a bicistronic expression unit for the olfactory receptor gene and a reporter gene (such as green fluorescent protein, GFP) are constructed to facilitate visualization of receptor expression . This approach allows for targeted expression in appropriate cellular environments, such as olfactory epithelium, where the necessary molecular machinery for receptor folding, trafficking, and signaling is present.

For functional validation of recombinant olfactory receptors, calcium imaging techniques have proven valuable. Fura-2 based Ca2+ imaging can be used to measure increases in intracellular Ca2+ levels in response to odorant stimulations, providing a direct readout of receptor activation . This methodology enables the assessment of ligand specificity and receptor functionality, critical parameters for characterizing recombinant OR4N2 and other olfactory receptors.

While specific studies focused on recombinant expression of OR4N2 are not detailed in the available literature, the methodologies established for other olfactory receptors provide a framework for future investigations. Application of these techniques to OR4N2 would likely yield valuable insights into its ligand specificity, activation mechanisms, and potential applications in biotechnology and medicine.

Genetic Variation and Copy Number Variation in OR4N2

Olfactory receptor genes, including OR4N2, exhibit substantial genetic variation within human populations, contributing to individual differences in olfactory perception. Copy number variations (CNVs), which involve the duplication or deletion of genomic segments, represent a significant source of this genetic diversity in the olfactory receptor gene family . High-resolution CNV mapping of olfactory receptor genes has revealed that approximately 55% of copy-number variable OR loci intersect with previously described CNVs, highlighting the extensive structural variation in this gene family .

The COSMIC database reports that among 49,130 unique samples analyzed, 848 samples exhibited mutations in OR4N2, indicating a mutation frequency of approximately 1.7% . This finding suggests that while OR4N2 is subject to genetic variation, it may be relatively conserved compared to other more highly variable olfactory receptor genes. The nature and functional consequences of these mutations remain areas for further investigation, particularly regarding their potential impact on olfactory perception or other physiological processes.

The evolutionary age of olfactory receptor genes appears to influence their susceptibility to copy number variation, with "younger" OR genes showing enrichment for CNVs compared to "ancient" ORs . This pattern may reflect decreased selective pressure on more recently evolved olfactory receptors or different CNV formation biases acting on genomic regions harboring genes of different evolutionary ages . The classification of OR4N2 in this evolutionary context and its specific patterns of variation warrant further investigation to understand its evolutionary history and functional significance.

A significant mechanism contributing to CNV formation in olfactory receptor genes involves non-allelic homologous recombination (NAHR) mediated by segmental duplications . Analysis at the level of genomic clusters of OR loci has revealed a significant enrichment of segmental duplication pairs among highly copy-number variable clusters, suggesting that NAHR has likely influenced the distribution of CNVs within the OR repertoire . The potential role of this mechanism in generating variation specifically in OR4N2 represents an important area for future research.

Functional Characterization of OR4N2

Functional characterization of olfactory receptors involves identifying their ligand specificity, activation mechanisms, and downstream signaling pathways. While detailed functional information specific to OR4N2 is limited in the available literature, established methodologies for characterizing olfactory receptors provide a framework for understanding its potential functional properties.

Odorant receptor-mediated signal transduction typically involves the activation of second messenger pathways, leading to calcium influx through ion channels . Elevations in cAMP or inositol-1,4,5-trisphosphate triggered by receptor activation can induce Ca2+ influx through cyclic nucleotide-gated channels or inositol trisphosphate-gated ion channels, respectively . These calcium signals can be measured using calcium-sensitive fluorescent dyes such as fura-2, providing a readout of receptor activation in response to odorant stimulation .

A powerful approach for identifying ligand specificity involves combining calcium imaging with single-cell reverse transcription-coupled PCR (RT-PCR) . This methodology allows for the correlation of odorant responses in individual neurons with the specific olfactory receptor genes expressed in those cells. For instance, this approach has been used to identify MOR23 as a receptor responsive to the odorant lyral, demonstrating the utility of this technique for elucidating receptor-ligand interactions .

While the specific ligands and activation properties of OR4N2 remain to be determined, its sequence characteristics and classification as an olfactory receptor suggest it likely functions in odorant recognition and signal transduction in olfactory sensory neurons. Future studies employing calcium imaging, recombinant expression systems, and molecular modeling approaches will be valuable for elucidating its functional properties and physiological significance.

Applications and Future Research Directions

Recombinant olfactory receptors, including potentially OR4N2, hold promise for various applications in biotechnology, medicine, and basic research. The development of biosensors based on recombinant olfactory receptors could enable the detection of specific odorants or chemicals with high sensitivity and specificity. Such biosensors might find applications in environmental monitoring, food quality assessment, or medical diagnostics.

Understanding the molecular properties and ligand specificity of OR4N2 could also contribute to the development of novel therapeutics targeting olfactory dysfunction. Olfactory disorders affect a significant portion of the population and can result from various causes, including genetic factors, traumatic injury, or neurodegenerative diseases. Recombinant olfactory receptors could serve as valuable tools for screening potential therapeutic compounds or for developing targeted interventions to address specific forms of olfactory dysfunction.

From a basic research perspective, detailed characterization of OR4N2 and other olfactory receptors contributes to our understanding of the molecular mechanisms underlying olfactory perception. The integration of structural, functional, and genetic information about specific olfactory receptors enhances our knowledge of sensory systems and their evolution. Comparative studies of OR4N2 across species could provide insights into the evolutionary history of this receptor and its functional significance in different ecological contexts.

Advanced technologies for studying olfactory receptors continue to emerge, offering new opportunities for investigating OR4N2 and other members of this gene family. High-throughput screening approaches, cryo-electron microscopy for structural determination, and CRISPR-based gene editing techniques represent powerful tools for future research in this field. The application of these methodologies to OR4N2 will likely yield valuable insights into its molecular properties and physiological functions.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
OR4N2; Olfactory receptor 4N2; Olfactory receptor OR14-13; Olfactory receptor OR14-8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR4N2
Target Protein Sequence
MESENRTVIREFILLGLTQSQDIQLLVFVLVLIFYFIILPGNFLIIFTIKSDPGLTAPLY FFLGNLAFLDASYSFIVAPRMLVDFLSAKKIISYRGCITQLFFLHFLGGGEGLLLVVMAF DRYIAICRPLHYPTVMNPRTCYAMMLALWLGGFVHSIIQVVLILRLPFCGPNQLDNFFCD VPQVIKLACTDTFVVELLMVFNSGLMTLLCFLGLLASYAVILCRIRGSSSEAKNKAMSTC ITHIIVIFFMFGPGIFIYTRPFRAFPADKVVSLFHTVIFPLLNPVIYTLRNQEVKASMKK VFNKHIA
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 14742

KEGG: hsa:390429

STRING: 9606.ENSP00000319601

UniGene: Hs.512490

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR4N2 and where is it expressed?

OR4N2 (olfactory receptor 4N2), also known as OR14-13 or OR14-8, is a 307 amino acid multi-pass membrane protein that belongs to the G protein-coupled receptor 1 family. The gene encoding OR4N2 consists of more than 900 bases and maps to human chromosome 14q11.2. As a member of the olfactory receptor family, OR4N2 is primarily expressed in olfactory sensory neurons in the nasal epithelium, where it functions in the detection of odorant molecules and initiation of neuronal responses that lead to the perception of smell . Like other olfactory receptors, OR4N2 shares the characteristic seven transmembrane domain structure common to G protein-coupled receptors, but is specifically involved in odorant signal recognition and transduction .

How does OR4N2 function in the olfactory system?

OR4N2 functions through a signal transduction cascade typical of olfactory receptors. When an appropriate odorant molecule binds to OR4N2, it activates G proteins, leading to increased production of second messengers such as cAMP or inositol-1,4,5-trisphosphate. These second messengers trigger Ca²⁺ influx through cyclic nucleotide-gated channels or inositol trisphosphate-gated ion channels . The resulting calcium increase initiates action potentials that transmit signals to the brain, ultimately leading to odor perception. The specificity of this process is remarkable, as each olfactory neuron typically expresses only a single odorant receptor gene, allowing for precise discrimination between different odorous compounds .

What is the genomic structure of the OR4N2 gene?

The OR4N2 gene is located on human chromosome 14q11.2 and consists of more than 900 bases . Like most olfactory receptor genes, OR4N2 has an intronless coding region, meaning its coding sequence is contained within a single exon. This genomic organization is characteristic of the OR gene family, which is the largest gene superfamily in the human genome . Chromosome 14, which houses the OR4N2 gene, comprises nearly 3.5% of the human genome and contains over 700 genes, including others involved in critical physiological functions and disease processes .

How does copy number variation affect OR4N2 expression and function?

Copy number variations (CNVs) can significantly impact OR4N2 expression and function. High-resolution oligonucleotide tiling microarray studies have revealed that OR genes, including OR4N2, are frequently affected by CNVs . These variations create a mosaic of OR dosages across individuals, potentially contributing to differences in olfactory perception. For OR genes in general, approximately 25% are commonly affected by CNVs . The effect of CNVs on OR4N2 specifically depends on whether they involve gene duplications (increasing copy number) or deletions (decreasing copy number). Duplications may lead to increased expression, potentially enhancing sensitivity to specific odorants, while deletions might reduce or eliminate the ability to detect certain smells .

What methodologies are most effective for recombinant expression of OR4N2?

Effective recombinant expression of OR4N2 can be achieved through several approaches, with adenovirus-mediated expression systems showing particular promise. This approach involves:

  • Cloning the OR4N2 gene into an adenoviral vector

  • Using a marker such as green fluorescent protein to track expression

  • Infecting target cells (often olfactory epithelium cells)

  • Confirming functional expression through calcium imaging techniques

This methodology has been successful with other olfactory receptors . Key considerations include:

  • Using proper signal sequences to ensure correct membrane insertion

  • Optimizing codon usage for the expression system

  • Incorporating chaperones to aid protein folding

  • Selecting appropriate cell types that can support GPCR trafficking

Functional validation can be performed using calcium imaging to detect odorant-induced responses, as has been demonstrated with other recombinant olfactory receptors .

How do evolutionary constraints affect OR4N2 compared to other olfactory receptors?

Evolutionary analyses reveal interesting patterns affecting OR4N2 and other olfactory receptors. Research indicates that ORs can be categorized as either "ancient" (having one-to-one orthologs in chimpanzees) or "young" (lacking such orthologs) . For OR genes in general, CNVs are enriched among ORs lacking a one-to-one ortholog in chimpanzee, suggesting these "young" ORs are more evolutionarily dynamic . Additionally, "young" ORs show significantly more losses than gains, while "ancient" ORs display more gains than losses . This pattern suggests differential selective pressures on different subsets of the OR repertoire. The specific evolutionary classification of OR4N2 would influence expectations about its stability across populations and potential functional variations .

What mechanisms drive copy number variation in OR4N2 and other olfactory receptor genes?

The primary mechanism driving copy number variation in olfactory receptor genes appears to be non-allelic homologous recombination (NAHR) between highly similar OR sequences . Research has revealed that ORs themselves, rather than their genomic environment, may frequently promote CNV formation through NAHR . Evidence for this includes cases where recombination between OR genes (e.g., between OR51A2 and OR51A4) results in new genes with chimeric sequences . This process is facilitated by the high sequence similarity between OR paralogs, which can serve as substrates for homologous recombination. For OR4N2 specifically, its genomic context and sequence similarity to other ORs would determine its susceptibility to NAHR-mediated copy number changes. The high degree of sequence homology among OR genes creates genomic instability that appears to drive ongoing evolution of the olfactory receptor repertoire .

How can single-cell techniques be applied to study OR4N2 expression and function?

Advanced single-cell techniques offer powerful approaches to studying OR4N2:

  • Single-cell RT-PCR: This technique can identify OR4N2 expression in individual olfactory neurons and can be coupled with functional calcium imaging to correlate receptor expression with odorant responses . The procedure involves:

    • Isolating individual olfactory neurons using tissue printing or microdissection

    • Performing calcium imaging to identify neurons responding to specific odorants

    • Collecting responsive cells in microcapillary tubes

    • Performing RT-PCR using degenerate primers or OR4N2-specific primers

    • Sequencing to confirm OR4N2 identity

  • Single-cell RNA sequencing: This provides a broader transcriptomic profile of OR4N2-expressing cells, revealing:

    • Co-expressed signaling components

    • Cell-specific variations in OR4N2 expression levels

    • Alternative splicing or promoter usage

These approaches have successfully identified olfactory receptors responding to specific odorants and characterized their signal transduction pathways .

What are the challenges and solutions for determining OR4N2 ligand specificity?

Determining ligand specificity for OR4N2 presents several challenges:

Table 1: Challenges and Solutions for OR4N2 Ligand Identification

ChallengeDescriptionMethodological Solution
Low expression levelsGPCRs often express poorly in heterologous systemsUse specialized expression systems (e.g., adenoviral vectors) with optimized trafficking signals
Improper foldingMisfolding in recombinant systems leads to non-functional proteinInclude chaperones; use mammalian cell lines with appropriate folding machinery
Ligand screening complexityThe "enormous range of odorants" makes comprehensive screening impracticalUse agonist-directed approach: identify responsive neurons first, then clone the receptor
Functional validationConfirming true ligand-receptor interactionsCombine Ca²⁺ imaging with recombinant expression to verify specificity
Structural motif recognitionDetermining which molecular features are recognizedUse structurally related odorants to map recognition patterns

A particularly effective approach combines:

  • Screening odorant responses in native olfactory neurons using calcium imaging

  • Single-cell RT-PCR to identify the receptor from responsive cells

  • Recombinant expression of the cloned receptor gene

  • Functional validation using the original and structurally similar odorants

This "two-step approach" has proven successful for other olfactory receptors and would be applicable to OR4N2 .

What are the optimal methods for designing functional expression studies of OR4N2?

Optimal functional expression of OR4N2 requires careful experimental design. Based on successful approaches with other olfactory receptors, an effective protocol would include:

  • Vector design considerations:

    • Use of adenoviral vectors, which show high transduction efficiency in olfactory neurons

    • Inclusion of a fluorescent marker (e.g., GFP) for tracking expression

    • Incorporation of appropriate promoters (e.g., CMV) for robust expression

  • Expression validation protocol:

    • Confirm protein expression via immunostaining or western blotting

    • Verify membrane localization using confocal microscopy

    • Assess functional response using calcium imaging upon odorant exposure

  • Functional analysis workflow:

    • Apply sequential odorant stimulations in a controlled chamber

    • Record intracellular calcium levels using fura-2 based imaging

    • Confirm cell viability with KCl-induced depolarization

    • Analyze structure-activity relationships using various odorant molecules

This methodology parallels approaches that have successfully reconstituted olfactory receptor-mediated signal transduction in previous studies . The use of single-cell calcium imaging followed by molecular identification provides a powerful means to link receptor structure with functional responses.

How can researchers address the challenges of CNV characterization in OR4N2 studies?

Characterizing CNVs affecting OR4N2 requires specialized methodologies:

  • High-resolution detection approaches:

    • Custom high-resolution oligonucleotide tiling microarrays specifically designed for OR gene regions

    • Quantitative PCR (qPCR) for validation of specific CNVs

    • Digital droplet PCR for absolute quantification of copy numbers

  • Data analysis considerations:

    • Normalization of microarray intensities to identify significant deviations

    • Statistical thresholds for calling CNVs (typically using log2-intensity ratios)

    • Population frequency calculations to distinguish common and rare variants

  • Validation strategies:

    • Confirmatory qPCR for suspected CNV regions

    • Long-read sequencing to characterize CNV breakpoints

    • Fosmid-based approaches to resolve complex structural variations

These methodologies have successfully identified OR loci affected by CNVs in previous studies, revealing that approximately 25% of OR genes show copy number variation across populations . When applying these techniques to OR4N2 specifically, researchers should consider its genomic context and sequence similarity to other ORs, which may influence CNV detection accuracy.

What approaches can be used to correlate OR4N2 genetic variation with functional outcomes?

Correlating OR4N2 genetic variation with functional outcomes requires integrative approaches:

  • Genotype-phenotype correlation methods:

    • Psychophysical testing of olfactory perception in subjects with known OR4N2 genotypes

    • In vitro functional testing of variant OR4N2 alleles

    • Calcium imaging to assess response profiles of different OR4N2 variants

  • Structural analysis approaches:

    • Homology modeling of OR4N2 protein structure

    • Docking simulations with potential ligands

    • Identification of critical residues for odorant binding

  • Population-level analyses:

    • Assessment of OR4N2 CNV frequency across different populations

    • Correlation with geographical or environmental factors

    • Evaluation of potential selective pressures

These approaches can help determine whether genetic variations in OR4N2—including SNPs, CNVs, or recombination events—correlate with differences in odorant perception or other functional outcomes. Previous studies have established that CNVs affecting ORs can contribute to individual differences in olfactory perception, with some OR deletions occurring at appreciable frequencies (estimated at approximately 0.2 in some populations) .

What are the emerging techniques that could advance OR4N2 research?

The field of OR4N2 research stands to benefit from several emerging technologies:

  • CRISPR/Cas9 gene editing for precise manipulation of OR4N2 in cellular and animal models, enabling:

    • Creation of knockout models to study loss of function

    • Introduction of specific variations to study structure-function relationships

    • Development of reporter systems for monitoring receptor activation

  • Organoid technology for creating more physiologically relevant test systems:

    • Olfactory epithelium organoids expressing native OR4N2

    • Patient-derived organoids to study person-specific variations

    • Complex co-culture systems modeling the olfactory neural circuit

  • Advanced computational approaches:

    • AlphaFold and similar AI systems for predicting OR4N2 structure

    • Machine learning algorithms to predict odorant-receptor interactions

    • Systems biology approaches to model the entire olfactory signaling network

These technologies will enable more nuanced studies of OR4N2 function, potentially revealing its specific role in odorant detection and discrimination, as well as implications for individual variation in olfactory perception.

How does OR4N2 research contribute to broader understanding of sensory perception?

OR4N2 research provides valuable insights into fundamental aspects of sensory perception:

  • Signal transduction mechanisms:

    • Understanding how G protein-coupled receptors convert chemical signals to electrical impulses

    • Clarifying the role of second messengers in amplifying sensory signals

    • Elucidating mechanisms of sensory adaptation and discrimination

  • Evolutionary perspectives:

    • Revealing how sensory receptor repertoires evolve through duplication, deletion, and recombination

    • Understanding the balance between conservation and diversification in sensory systems

    • Clarifying how CNVs contribute to ongoing evolution of sensory perception

  • Individual variation in perception:

    • Providing molecular explanations for differences in olfactory sensitivity and preference

    • Connecting genetic variation to perceptual phenotypes

    • Establishing frameworks applicable to other sensory modalities

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.