Recombinant Human Olfactory receptor 4N5 (OR4N5)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Human Olfactory Receptor 4N5 (OR4N5) is a laboratory-engineered form of the olfactory receptor OR4N5, a class II G protein-coupled receptor (GPCR) belonging to the largest multigene family in vertebrates . OR4N5 is encoded by the OR4N5 gene (HGNC: 15358) and is classified under olfactory receptor family 4, subfamily N, member 5 . Recombinant production enables biochemical and functional studies of this receptor, which is otherwise challenging to isolate due to its membrane-bound nature and low natural expression levels .

Recombinant Production Systems

OR4N5 has been expressed in multiple heterologous systems to study its biochemical properties:

Expression SystemProduct CodeTag/ModificationSource
YeastCSB-YP810288HU1NativeCusabio
E. coliCSB-EP810288HU1N-terminal 10xHisCusabio
BaculovirusCSB-BP810288HU1NativeCusabio
Mammalian CellsCSB-MP810288HU1NativeCusabio
E. coli (Biotinylated)CSB-EP810288HU1-BAviTag-BirA biotinylationCusabio

These variants are used for ligand-binding assays, structural studies, and antibody development .

Functional Insights

  • Ligand Specificity: Unlike OR1D2 (activated by bourgeonal) or OR7A5 (activated by furanones), OR4N5’s odorant ligands are unidentified .

  • Calcium Signaling: No direct evidence links OR4N5 activation to calcium flux in spermatozoa, a hallmark of other olfactory receptors .

  • Metalloprotein Interaction: OR4N5 lacks the conserved metal ion-binding site found in some olfactory receptors, which modulates ligand affinity .

Database Curation

OR4N5 is cataloged in genomic databases (e.g., STRING: 9606.ENSP00000493307, KEGG: hsa:390437) but is absent from ligand interaction databases like M2OR, which covers 51,395 OR-odorant pairs .

Challenges and Future Directions

  • Deorphanization: OR4N5 remains an "orphan receptor" with no confirmed ligands. High-throughput screening using recombinant variants could resolve this .

  • Functional Studies: Structural predictions (e.g., AlphaFold models) require experimental validation .

  • Spermatozoal Role: Further immunohistochemical studies are needed to confirm OR4N5’s presence in sperm and its physiological role .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs by default. For dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR4N5; Olfactory receptor 4N5; Olfactory receptor OR14-33
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR4N5
Target Protein Sequence
METQNLTVVTEFILLGLTQSQDAQLLVFVLVLIFYLIILPGNFLIIFTIKSDPGLTAPLY FFLGNLALLDASYSFIVVPRMLVDFLSEKKVISYRSCITQLFFLHFLGAGEMFLLVVMAF DRYIAICRPLHYSTIMNPRACYALSLVLWLGGFIHSIVQVALILHLPFCGPNQLDNFFCD VPQVIKLACTNTFVVELLMVSNSGLLSLLCFLGLLASYAVILCRIREHSSEGKSKAISTC TTHIIIIFLMFGPAIFIYTCPFQAFPADKVVSLFHTVIFPLMNPVIYTLRNQEVKASMRK LLSQHMFC
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15358

KEGG: hsa:390437

STRING: 9606.ENSP00000332110

UniGene: Hs.553766

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR4N5 and how is it classified within the olfactory receptor family?

Basic Research Question

OR4N5 (olfactory receptor, family 4, subfamily N, member 5) is a human olfactory receptor belonging to the largest subfamily of G-protein coupled receptors (GPCRs) in the human genome. Olfactory receptors comprise approximately half of the 800 GPCRs encoded by the human genome . The classification system for olfactory receptors places OR4N5 in family 4, subfamily N, which reflects its phylogenetic relationship to other olfactory receptors based on sequence homology and evolutionary conservation.

The receptor contains 308 amino acids in its full-length form and follows the typical GPCR structure with seven transmembrane domains . Researchers investigating OR4N5 should note that like other olfactory receptors, it likely contains an extracellular N-terminus, three extracellular loops, three intracellular loops, and an intracellular C-terminus, though specific structural details of OR4N5 have not been as thoroughly characterized as some other olfactory receptors like OR51E2 .

What expression systems are most effective for producing recombinant OR4N5?

Basic Research Question

For recombinant production of OR4N5, prokaryotic expression systems, particularly E. coli, have been successfully employed to generate full-length OR4N5 protein with terminal tags to facilitate purification . The methodology involves:

  • Cloning the full-length OR4N5 coding sequence (residues 1-308) into an appropriate expression vector

  • Transformation into an E. coli expression strain optimized for membrane protein production

  • Induction of protein expression under controlled conditions

  • Extraction using detergents suitable for membrane proteins

  • Purification via affinity chromatography using the His-tag

Researchers should note that olfactory receptors are notoriously difficult to express and purify in sufficient quantities for structural studies due to their hydrophobic nature and instability when removed from the membrane environment . Alternative expression systems to consider include:

  • Yeast expression systems (e.g., Pichia pastoris)

  • Baculovirus-infected insect cells

  • Mammalian cell lines for functional studies

Each system offers different advantages in terms of post-translational modifications, protein folding, and functional integrity.

What are the optimal methods for detecting OR4N5 expression in tissue samples?

Advanced Research Question

Detection of OR4N5 in tissue samples requires a combination of techniques targeting both transcript and protein levels:

Transcript-level detection:

  • RT-PCR using validated OR4N5-specific primers: 5′-ctgcacttgcctttctgtgg-3′ and 5′-atatgggtggtgcatgtgga-3′

  • Quantitative real-time PCR (qPCR) for relative expression quantification

  • RNA-Seq for comprehensive transcriptome analysis

Protein-level detection:

  • Immunohistochemistry using validated anti-OR4N5 antibodies

  • Western blotting for semi-quantitative protein detection

  • Mass spectrometry for proteomic analysis

When performing RT-PCR detection, researchers should follow these methodological steps:

  • Extract high-quality RNA from tissue samples (RNA quality can be verified using A260/A280 ratio analysis)

  • Perform cDNA synthesis using reverse transcriptase

  • Include appropriate controls (no-RT controls to exclude genomic DNA contamination)

  • Use the validated primers for OR4N5 amplification

  • Run PCR for 40 cycles (45 s at 94°C, 45 s at 60°C, 45 s at 72°C)

  • Verify product size by gel electrophoresis

This approach has been successfully used to detect olfactory receptor expression in non-nasal tissues, such as melanocytes, where OR4N5 transcripts were investigated alongside other olfactory receptors .

How can researchers verify the functional integrity of recombinant OR4N5?

Advanced Research Question

  • Ligand binding assays:

    • Radiolabeled or fluorescently labeled potential ligands

    • Surface plasmon resonance (SPR)

    • Microscale thermophoresis (MST)

  • Functional coupling assays:

    • cAMP accumulation assays (Gs coupling)

    • Calcium mobilization assays (Gq coupling)

    • ERK phosphorylation (various G protein pathways)

    • β-arrestin recruitment assays

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Tryptophan fluorescence to monitor tertiary structure

    • Thermal stability assays

Researchers working with recombinant OR4N5 should consider developing specialized functional assay systems, particularly if the receptor exhibits high basal activity, which can complicate traditional activation assays . The methodological approach described for other olfactory receptors with high basal activity may be adaptable for OR4N5 characterization .

What protein-protein interactions have been identified for OR4N5?

Advanced Research Question

OR4N5 has been reported to engage in various protein-protein interactions, though the comprehensive interactome remains to be fully characterized . The methodological approaches for identifying these interactions include:

  • Yeast two-hybrid (Y2H) screening:

    • Using OR4N5 as bait against cDNA libraries

    • Verification of positive hits through secondary screening

    • Mapping interaction domains

  • Co-immunoprecipitation (Co-IP):

    • Using anti-OR4N5 antibodies to pull down interacting partners

    • Reverse Co-IP with antibodies against putative interacting proteins

    • Mass spectrometry identification of co-precipitated proteins

  • Pull-down assays:

    • Using recombinant His-tagged OR4N5

    • GST-tagged potential interacting partners

    • Affinity-based isolation followed by western blot or mass spectrometry

  • Proximity labeling techniques:

    • BioID or APEX2 fusion to OR4N5

    • Identification of proximal proteins in living cells

    • MS/MS analysis of biotinylated proteins

While specific interacting partners are not fully enumerated in the available search results, researchers investigating OR4N5 should focus on:

a) Canonical GPCR-interacting proteins (G proteins, arrestins, GRKs)
b) Chaperones involved in OR trafficking and membrane insertion
c) Scaffold proteins that may organize signaling complexes
d) Regulatory proteins that control OR4N5 expression or degradation

How does OR4N5 compare structurally and functionally to other characterized olfactory receptors like OR51E2?

Advanced Research Question

While the precise structural details of OR4N5 have not been as thoroughly characterized as OR51E2, comparative analysis provides valuable insights:

Structural Comparison:
OR51E2 has been structurally characterized by cryo-electron microscopy, revealing its 3D conformation and interaction with propionate through specific binding pocket residues, particularly involving an arginine "on switch" that forms ionic and hydrogen bonds with the ligand . Although OR4N5's structure has not been similarly resolved, sequence analysis and homology modeling can predict structural features based on OR51E2 and other GPCRs.

Functional Comparison:
While OR51E2 has been functionally characterized in both olfactory and non-olfactory tissues (including epidermal melanocytes where it responds to β-ionone stimulation) , the specific ligands and functional roles of OR4N5 remain less defined. OR51E2 activation in melanocytes inhibits proliferation and stimulates melanogenesis and dendritogenesis through calcium signaling . Similar extrasensory functions might exist for OR4N5 but require further investigation.

Methodological approaches for comparative analysis:

  • Sequence alignment and phylogenetic analysis

  • Homology modeling based on OR51E2 structure

  • Comparative expression profiling across tissues

  • Parallel functional assays using common methodologies

  • Cross-reactivity testing with known OR51E2 ligands

Researchers should note that OR51E2 gained research attention partly due to its atypical stability and expression in non-olfactory tissues , factors that might guide similar investigations for OR4N5.

What approaches can be used to identify potential ligands for OR4N5?

Advanced Research Question

Identifying ligands for olfactory receptors, including OR4N5, presents significant challenges due to the vast chemical space of potential odorants. Several methodological approaches can be employed:

  • High-throughput screening:

    • Calcium imaging in heterologous expression systems

    • FLIPR-based fluorescence assays

    • Impedance-based cellular assays (e.g., xCELLigence)

    • Reporter gene assays (e.g., luciferase)

  • In silico prediction:

    • Homology modeling based on known olfactory receptor structures (e.g., OR51E2)

    • Molecular docking of virtual odorant libraries

    • Machine learning approaches trained on known receptor-ligand pairs

    • Pharmacophore modeling

  • Directed screening based on chemoinformatics:

    • Testing compounds with structural similarity to ligands of phylogenetically related receptors

    • Screening focused libraries of compounds sharing chemical features

    • Testing compounds found in tissues where OR4N5 is expressed

  • Unbiased metabolomic approaches:

    • Activity-guided fractionation of complex biological samples

    • Untargeted metabolomics of tissues expressing OR4N5

    • Comparison of metabolites from responsive vs. non-responsive tissues

When testing potential agonists, researchers should consider the following experimental design elements:

  • Use multiple orthogonal assay systems to confirm activity

  • Include appropriate positive controls (known GPCR activators)

  • Test for dose-dependent responses

  • Assess receptor specificity through comparison with related ORs

  • Consider potential allosteric modulators alongside direct agonists

What experimental systems best capture the functional properties of OR4N5 in vitro?

Advanced Research Question

Selecting appropriate experimental systems for OR4N5 functional characterization requires careful consideration of the receptor's native environment and signaling properties:

  • Heterologous expression systems:

    • HEK293 cells (widely used for GPCR studies)

    • HeLa cells

    • Chinese Hamster Ovary (CHO) cells

    • Specialized RTP1S/REEP1-expressing cells (enhanced OR trafficking)

  • Signaling readout systems:

    Signaling PathwayReadout MethodAdvantagesLimitations
    Gαolf/Gs-cAMPFRET-based cAMP sensorsReal-time monitoring, single-cell resolutionRequires genetic modification
    Gαq-calciumCalcium-sensitive dyes (Fluo-4, Fura-2)High sensitivity, temporal resolutionBackground responses, loading variability
    ERK activationPhospho-ERK immunoblottingDetects downstream effectsEnd-point assay, low throughput
    β-arrestin recruitmentBRET/FRET biosensorsDirect measurement of receptor activationMay not capture G-protein independent signaling
  • Specialized approaches for difficult-to-express ORs:

    • Cell-free expression systems

    • Nanodiscs for membrane protein stabilization

    • Fusion with helper proteins (e.g., T4 lysozyme)

    • Novel functional assay systems designed for ORs with high basal activity

For challenging olfactory receptors, specialized techniques like those described for receptors with high basal activity may be necessary . Additionally, researchers should consider whether OR4N5 exhibits constitutive activity, which would require different experimental approaches than those used for receptors with low basal activity.

What evidence exists for non-olfactory functions of OR4N5 in human tissues?

Basic Research Question

While the primary role of olfactory receptors is in odorant detection in nasal olfactory neurons, growing evidence suggests that many ORs, including potentially OR4N5, have non-olfactory functions in other tissues:

  • Expression evidence:

    • RT-PCR analysis has been used to detect OR4N5 transcripts in various tissues

    • Studies investigating OR expression in melanocytes included OR4N5 in their screening panel

    • The presence of OR4N5 in non-nasal tissues suggests potential physiological roles beyond olfaction

  • Functional evidence by analogy:

    • Other olfactory receptors like OR51E2 have demonstrated functions in melanocytes, affecting proliferation, melanogenesis, and dendritogenesis

    • These findings suggest a potential framework for investigating OR4N5 functions in similar cell types

  • Methodological approach to investigating non-olfactory functions:

    • Tissue expression profiling using RT-PCR and qPCR

    • Functional studies with siRNA knockdown (similar to approaches used for OR51E2)

    • Stimulation with potential ligands followed by assessment of cellular functions

    • Calcium imaging to detect receptor activation in non-neuronal cells

Researchers interested in non-olfactory functions of OR4N5 should systematically investigate:

  • Expression patterns across different tissues and cell types

  • Effects of receptor knockdown/overexpression on cellular physiology

  • Identification of tissue-specific ligands that may act through OR4N5

  • Downstream signaling pathways activated by OR4N5 in different cellular contexts

How does OR4N5 compare to other olfactory receptors in terms of evolutionary conservation?

Advanced Research Question

Evolutionary analysis of OR4N5 provides insights into its functional importance and potential specialization across species:

  • Phylogenetic analysis methodologies:

    • Multiple sequence alignment of OR4N5 orthologs across species

    • Calculation of sequence conservation scores for different protein domains

    • Identification of positively and negatively selected sites

    • Ancestral sequence reconstruction

  • Comparative analysis with other OR families:

    • Assessment of relative conservation rates between OR4N5 and other OR family members

    • Identification of OR4N5-specific sequence motifs

    • Comparison of binding pocket residues with functionally characterized ORs like OR51E2

  • Structural implications of evolutionary patterns:

    • Mapping conservation data onto structural models

    • Identifying evolutionary constraints on specific protein regions

    • Predicting functionally important residues based on conservation

Researchers should note that olfactory receptors as a family show high variability between species, reflecting adaptation to different ecological niches and odorant environments. Understanding where OR4N5 fits in this evolutionary landscape can provide clues to its functional specificity and importance.

What are the common challenges in expressing and purifying recombinant OR4N5?

Basic Research Question

Researchers working with recombinant OR4N5 face several technical challenges common to membrane proteins and particularly olfactory receptors:

  • Expression challenges:

    • Low expression levels due to protein toxicity

    • Improper folding in heterologous systems

    • Retention in intracellular compartments

    • Aggregation due to hydrophobic transmembrane domains

  • Purification obstacles:

    • Difficulty in extracting from membranes

    • Detergent-induced destabilization

    • Loss of native conformation during purification

    • Low yields insufficient for structural studies

  • Methodological solutions:

    ChallengeSolution ApproachImplementation Details
    Poor expressionUse specialized expression hostsC41(DE3), C43(DE3) E. coli strains designed for membrane proteins
    Improper foldingLower induction temperatureReduce to 16-18°C during protein expression phase
    Intracellular retentionCo-express with chaperonesGroEL/GroES, DnaK/DnaJ/GrpE systems
    Membrane extractionOptimize detergent screeningTest mild detergents (DDM, LMNG) at various concentrations
    Protein instabilityAdd stabilizing agentsCholesterol, specific lipids, ligands during purification
  • Quality control approaches:

    • Size exclusion chromatography to assess monodispersity

    • Thermostability assays to optimize buffer conditions

    • Circular dichroism to verify secondary structure

    • Binding assays to confirm functional integrity

Researchers should note that olfactory receptors are among the most challenging GPCRs to work with, and techniques used for more stable receptors like OR51E2 may require adaptation for OR4N5.

What strategies can overcome the challenges in identifying specific ligands for OR4N5?

Advanced Research Question

Ligand identification for olfactory receptors presents unique challenges due to their broad tuning properties and the vast chemical space of potential odorants:

  • Deorphanization strategies:

    • Sequential screening of odorant libraries starting with chemically diverse compounds

    • Focused testing based on chemical similarity to ligands of phylogenetically related ORs

    • Structure-based virtual screening using homology models

    • Fragment-based approaches testing molecular substructures

  • Assay optimization for challenging receptors:

    • Development of specialized assay systems for receptors with high basal activity

    • Use of chimeric G proteins to enhance coupling efficiency

    • Implementation of amplification steps in signaling detection

    • Development of more sensitive biosensors

  • Alternative approaches when conventional methods fail:

    • In vivo screening using transgenic systems

    • Computational prediction based on machine learning

    • Metabolomic identification of native ligands from tissues expressing OR4N5

    • Activity-guided fractionation of complex biological samples

  • Validation strategies for putative ligands:

    • Dose-response analysis across a wide concentration range

    • Competitive binding studies

    • Structure-activity relationship analysis with chemical analogs

    • Cross-validation in multiple assay systems

Researchers should consider that ligand identification may be complicated by potential allosteric modulators, biased signaling through different pathways, or context-dependent activation profiles that vary across different cell types expressing OR4N5.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.