Recombinant Human Olfactory receptor 4S1 (OR4S1)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant OR4S1 is generated using advanced biotechnological workflows:

  • Vector Design: Incorporates epitope tags (e.g., His, FLAG) for immunoaffinity purification .

  • Purification Steps:

    1. Anti-FLAG affinity chromatography

    2. Gel filtration for monomer/dimer separation .

  • Yield: Up to 1.6 mg (monomer) and 1.1 mg (dimer) per 60 T175 flasks .

Quality Control:

  • Confirmed via circular dichroism (proper folding) .

  • Ligand binding validated using tryptophan fluorescence assays .

Role in Reproductive Biology

OR4S1 exhibits unexpected roles beyond olfaction:

  • Sperm Function: Localized to the acrosome, midpiece, and flagellum of human sperm .

    • Expression Reduction: Diminished in spermatocyte maturation arrest .

    • Chemotaxis: May guide sperm migration via odorant interactions .

TissueExpression PatternCitation
TestisSpermatocytes, spermatids
EpididymisDiffuse staining in ductal epithelium
Seminal PlasmaDetected via proteomics (≥8 ORs present)

Available Products

VendorProduct TypeCatalog #Price (USD)
MyBioSourceRecombinant ProteinMBS7024923$1,795/0.02 mg
Creative BioMartHis-Tagged ProteinRFL2020HFCustom pricing
AbbexaELISA Kitabx514665$1,199

Assay Parameters (ELISA)

  • Detection Range: 0.156–10 ng/ml .

  • Sample Types: Tissue homogenates, cell lysates .

Challenges and Future Directions

  • Ligand Identification: OR4S1 remains partially "orphan" with no confirmed native ligands .

  • Structural Studies: Crystallography/NMR required to resolve activation mechanisms .

  • Clinical Relevance: Potential biomarker for male infertility linked to maturation arrest .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
OR4S1; Olfactory receptor 4S1; Olfactory receptor OR11-100
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR4S1
Target Protein Sequence
MGAKNNVTEFVLFGLFESREMQHTCFVVFFLFHVLTVLGNLLVIITINARKTLKSPMYFF LSQLSFADICYPSTTIPKMIADTFVEHKIISFNGCMTQLFSAHFFGGTEIFLLTAMAYDR YVAICRPLHYTAIMDCRKCGLLAGASWLAGFLHSILQTLLTVQLPFCGPNEIDNFFCDVH PLLKLACADTYMVGLIVVANSGMISLASFFILIISYVIILLNLRSQSSEDRRKAVSTCGS HVITVLLVLMPPMFMYIRPSTTLAADKLIILFNIVMPPLLNPLIYTLRNNDVKNAMRKLF RVKRSLGEK
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 14705

KEGG: hsa:256148

STRING: 9606.ENSP00000321447

UniGene: Hs.553657

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Human Olfactory Receptor 4S1?

Human Olfactory Receptor 4S1 (OR4S1) belongs to the class A G-protein-coupled receptor (GPCR) superfamily. Like other olfactory receptors, OR4S1 interacts with odorant molecules in the nasal epithelium to initiate neuronal responses that trigger smell perception . Structurally, OR4S1 is a seven-transmembrane domain protein that couples with G-proteins to transduce signals through second messenger systems upon odorant binding. The receptor contains both extracellular domains that interact with odorants and intracellular domains that interact with signaling machinery.

The functional characterization of olfactory receptors often reveals they can respond to a range of odorants with varying affinities, though many show selectivity for structurally related compounds. Complete functional characterization of OR4S1's ligand specificity profile requires systematic screening with diverse odorant panels.

What expression systems are most effective for recombinant production of OR4S1?

Based on successful approaches with other human olfactory receptors, heterologous expression systems such as Human Embryonic Kidney 293 (HEK293) cells represent an effective platform for recombinant OR4S1 production. For example, studies with other human ORs have utilized tetracycline-inducible HEK293S cell lines for controlled expression .

For functional studies, both transient and stable transfection approaches have proven useful. Researchers have successfully used HEK293 cells for calcium imaging assays with human olfactory receptors . Additionally, Hana3A cells (HEK293T derivative cells with enhanced OR expression) can be used with luciferase reporter assays to measure receptor activation .

For non-mammalian expression, the Xenopus laevis oocyte system has been employed successfully for functional expression of human olfactory receptors and subsequent electrophysiological characterization using voltage clamp techniques .

What epitope tags are recommended for purification and detection of recombinant OR4S1?

When engineering recombinant OR4S1 for purification and detection, dual-tagging strategies have proven effective for other human olfactory receptors. A recommended approach based on successful studies with other ORs includes:

  • N-terminal FLAG epitope tag for immunoaffinity purification

  • C-terminal rho1D4 epitope tag for detection and secondary purification steps

This dual-tagging strategy facilitates a two-step purification process (anti-FLAG immunoaffinity purification followed by gel filtration) while maintaining receptor functionality. Studies with similarly tagged olfactory receptors have demonstrated that this approach yields properly folded and functional receptors that retain their ability to bind cognate odorants .

What methodologies are most effective for assessing OR4S1 activation in response to potential ligands?

Multiple complementary approaches can be employed to characterize OR4S1 activation:

  • cAMP-dependent luciferase reporter assays: This high-throughput approach utilizes cells co-transfected with OR4S1 and a cAMP-responsive luciferase reporter. Upon receptor activation and subsequent cAMP production, luciferase expression increases, providing a quantifiable signal . The assay setup typically includes:

    • Transfection with OR4S1, RTP1S (receptor transporting protein), CRE-luciferase reporter, and Renilla luciferase (for normalization)

    • Stimulation with test odorants at various concentrations

    • Measurement of luminescence using a plate reader

    • Normalization to Renilla luciferase activity to control for transfection efficiency

  • Calcium imaging: For receptors coupled to calcium signaling pathways, intracellular Ca²⁺ flux can be measured using fluorescent calcium indicators. This approach provides temporal resolution of receptor activation and has been successfully used with human olfactory receptors .

  • Electrophysiological recordings: For OR4S1 expressed in systems like Xenopus oocytes, measuring conductance changes through voltage clamp recordings provides direct assessment of receptor-activated ion channel activity. Protocols typically involve:

    • Voltage ramps from -50 to +50 mV or voltage steps to measure conductance changes

    • Normalization to responses elicited by control compounds such as IBMX (3-isobutyl-1-methylxanthine)

How can ligand binding to purified OR4S1 be quantified in vitro?

For direct quantification of ligand binding to purified OR4S1, intrinsic tryptophan fluorescence assays represent an effective biophysical approach. This methodology leverages the natural fluorescence of tryptophan residues, which can change upon ligand binding due to conformational shifts in the receptor structure.

The experimental workflow, based on successful approaches with other olfactory receptors, would include:

  • Purification of detergent-solubilized OR4S1 using the dual-tag approach

  • Baseline fluorescence measurement of the purified receptor

  • Titration with increasing concentrations of potential ligands

  • Quantification of fluorescence changes to determine binding affinity (typically in the micromolar range for olfactory receptors)

This approach allows determination of dissociation constants (Kd) and provides insights into the thermodynamics of ligand-receptor interactions under controlled in vitro conditions.

What strategies can overcome common challenges in structural characterization of OR4S1?

Structural characterization of olfactory receptors presents significant challenges due to their hydrophobicity, conformational heterogeneity, and typically low expression levels. Advanced strategies to overcome these obstacles include:

  • Protein engineering approaches:

    • Introduction of thermostabilizing mutations based on computational predictions

    • Creation of receptor-T4 lysozyme fusion proteins to enhance crystallizability

    • Nanobody-assisted stabilization of specific conformational states

  • Advanced purification protocols:

    • Two-step purification using orthogonal affinity tags (FLAG and rho1D4)

    • Size exclusion chromatography to separate monomeric and dimeric forms

    • Lipid nanodisc reconstitution to maintain native-like membrane environment

  • Biophysical characterization techniques:

    • Circular dichroism spectroscopy to confirm proper folding

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to assess oligomeric state

    • Negative-stain electron microscopy for initial structural evaluation

These approaches facilitate the production of homogeneous, stable receptor preparations suitable for advanced structural studies via X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy.

How should screening experiments be designed to identify OR4S1 ligands?

A systematic approach to ligand identification for OR4S1 should incorporate the following elements:

  • Primary screening: Test a diverse odorant panel at a fixed concentration (typically 100 μM) against cells expressing OR4S1 and appropriate controls. A luciferase-based cAMP assay represents an efficient readout system for this initial phase .

  • Secondary screening: For hits identified in the primary screen:

    • Test each compound at multiple concentrations (e.g., 1, 10, and 100 μM)

    • Include appropriate negative controls (cells transfected with empty vector)

    • Perform each condition in triplicate for statistical validation

  • Dose-response characterization: For confirmed hits, construct complete dose-response curves:

    • Use concentrations ranging from nanomolar to millimolar (e.g., 10 nM to 10 mM)

    • Fit data to sigmoidal curves to determine EC50 values

    • Apply statistical tests to confirm significant activation above baseline

This hierarchical approach enables efficient identification of OR4S1 ligands while minimizing false positives through progressively more stringent validation steps.

What criteria should be applied to determine if an odorant is a genuine OR4S1 agonist?

Based on established standards in the field, an odorant should meet the following criteria to be classified as a genuine OR4S1 agonist:

  • The 95% confidence intervals of the top and bottom parameters of the dose-response curve should not overlap, indicating a statistically significant response range .

  • The standard deviation of the fitted log EC50 should be less than 1 log unit, demonstrating reliable potency estimation .

  • Statistical comparison (e.g., extra sum-of-squares test) should confirm that the odorant activates OR4S1 significantly more than the control (empty vector-transfected cells) .

  • The response should be reproducible across independent experiments and different batches of transfected cells.

  • Structure-activity relationship analysis with structural analogs should demonstrate specificity (as seen with helional and heliotroplyacetone activating OR17-40, while related compounds like piperonal were ineffective) .

How can subfamily relationships inform OR4S1 ligand prediction?

Olfactory receptors can be classified into subfamilies based on sequence similarity, with members of the same subfamily often recognizing structurally related odorants. This evolutionary relationship provides a valuable framework for predicting potential OR4S1 ligands:

  • Identify the specific subfamily to which OR4S1 belongs within the human OR family, which comprises 172 subfamilies .

  • Analyze known ligands for other members of the same subfamily. The table below shows examples of how subfamily relationships can inform ligand prediction for various olfactory receptors:

LocusOR (MOR#)Amino acid identity, %Odorant(s) recognizedPerceived odor
1q22OR23(267-13)87LyralLemony, green
5q35.3IG7(276-1)83LimoneneLemon
9q34.11ID3(136-6)71I-carvoneSpearmint, caraway
11q12.1OR73(174-9)82EugenolSpicy
11q12.1OR74(174-4)76Ethyl vanillinVanilla
11q12.2OR912-93(175-1)662-HeptanoneFruity
11p15.4S25(204-32)74n-aliphatic alcoholsHerbal, woody, orange, rose
  • Perform sequence similarity analysis between OR4S1 and olfactory receptors with known ligands to identify potential binding pocket similarities .

  • Prioritize testing of compounds that activate other members of the subfamily to which OR4S1 belongs.

This approach leverages evolutionary relationships to narrow the vast chemical space of potential odorants, increasing the efficiency of ligand discovery efforts.

How should researchers address variability in OR4S1 functional expression across different systems?

Functional expression of olfactory receptors, including OR4S1, can vary significantly across expression systems, leading to potential inconsistencies in experimental results. To address this challenge:

  • Include accessory proteins that enhance functional expression:

    • Receptor transporting proteins (RTPs), particularly RTP1S

    • Receptor expression enhancing protein (REEP)

    • Olfactory G protein (Golf)

  • Implement quantitative quality control measures:

    • Quantify surface expression using flow cytometry with N-terminal epitope tags

    • Normalize functional responses to expression levels

    • Include well-characterized olfactory receptors as positive controls in each experiment (e.g., OR1A1 with dihydrojasmone)

  • Validate findings across multiple expression platforms:

    • Compare results between transient and stable expression systems

    • Test both mammalian cell lines and non-mammalian systems like Xenopus oocytes

    • Confirm key findings with both fluorescence-based and luminescence-based assays

This multifaceted approach ensures that observed functional properties of OR4S1 reflect intrinsic receptor characteristics rather than artifacts of the expression system.

What is the significance of monomeric versus dimeric forms of recombinant OR4S1?

Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) analysis of purified olfactory receptors has revealed the presence of both monomeric and dimeric forms . For OR4S1 research, understanding the significance of these different oligomeric states requires addressing the following questions:

  • Functional differences: Do monomeric and dimeric forms of OR4S1 exhibit different ligand binding properties or activation kinetics? Separate purification and functional characterization of each form can address this question.

  • Physiological relevance: Is receptor dimerization a physiologically relevant mechanism or an artifact of overexpression? Crosslinking studies in native tissues can help determine if dimers exist under physiological conditions.

  • Structural implications: How does dimerization affect receptor structure? Computational modeling and structural studies comparing monomeric and dimeric forms can provide insights into potential allosteric mechanisms.

  • Technological applications: Can the stability or functionality of recombinant OR4S1 be enhanced by promoting specific oligomeric states through protein engineering approaches?

Understanding these aspects is crucial for accurate interpretation of experimental results and for optimizing recombinant OR4S1 for various research applications.

How can researchers distinguish between direct and indirect activation of OR4S1?

When characterizing OR4S1 responses to potential ligands, distinguishing between direct receptor activation and indirect effects mediated by cellular components is critical:

  • Direct binding assays with purified receptor:

    • Intrinsic tryptophan fluorescence measurements with purified OR4S1

    • Surface plasmon resonance or isothermal titration calorimetry with purified receptor

    • These approaches demonstrate physical interaction between ligand and receptor

  • Structure-activity relationship (SAR) studies:

    • Testing structural analogs with systematic modifications

    • A coherent SAR pattern suggests direct receptor-ligand interaction

    • Example: Specific activation by helional and heliotroplyacetone but not by related compounds like piperonal suggests direct receptor activation

  • Site-directed mutagenesis of predicted binding site residues:

    • Identification of key residues through computational modeling

    • Mutation of these residues should alter response to direct ligands

    • Conservation of these residues among subfamily members with similar ligand preferences provides additional evidence for direct interaction

  • Heterologous expression contexts:

    • Testing receptor activation in multiple cell types with different endogenous signaling components

    • Consistent activation profiles across systems support direct receptor targeting

These complementary approaches provide robust evidence for distinguishing between direct OR4S1 agonists and compounds that produce receptor activation through indirect mechanisms.

How might single-cell sequencing technologies advance understanding of OR4S1 expression patterns?

Single-cell RNA sequencing (scRNA-seq) offers unprecedented opportunities to characterize the expression of OR4S1 within the olfactory epithelium:

  • Cell-type specific expression:

    • Determine if OR4S1 follows the "one neuron-one receptor" rule characteristic of olfactory sensory neurons

    • Identify potential exceptions to this rule and co-expression patterns with other receptors

    • Map expression to specific zones within the olfactory epithelium

  • Developmental trajectories:

    • Track OR4S1 expression during neuronal development and maturation

    • Identify transcription factors and regulatory elements associated with OR4S1 expression

    • Characterize the stabilization of receptor choice during olfactory neuron development

  • Comparative analysis:

    • Compare OR4S1 expression patterns across individuals to assess variability

    • Identify potential correlations between expression patterns and olfactory perception

    • Examine expression in individuals with specific anosmias or hyperosmias

These applications of single-cell technologies will provide a comprehensive understanding of OR4S1's role within the complex landscape of olfactory receptor expression.

What computational approaches can predict OR4S1 structure-function relationships?

Advanced computational methods offer powerful tools for investigating OR4S1 structure and function:

  • Homology modeling and molecular dynamics:

    • Generate structural models of OR4S1 based on crystal structures of other GPCRs

    • Refine models through extended molecular dynamics simulations in membrane environments

    • Identify potential binding pockets and key residues involved in ligand recognition

  • Virtual screening and docking:

    • Screen virtual libraries of odorants against OR4S1 structural models

    • Rank compounds based on predicted binding affinities and interaction patterns

    • Prioritize candidates for experimental validation

  • Machine learning approaches:

    • Develop predictive models of OR4S1 activation based on physicochemical properties of odorants

    • Train models using experimental data from related olfactory receptors

    • Apply transfer learning to improve predictions despite limited OR4S1-specific data

  • Network analysis of subfamily relationships:

    • Analyze sequence similarities and evolutionary relationships across the OR family

    • Identify conserved motifs associated with recognition of specific chemical features

    • Predict OR4S1 ligand preferences based on subfamily clustering

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.