Recombinant Human Olfactory receptor 4S2 (OR4S2)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Characteristics

Olfactory receptor 4S2 (OR4S2) is officially named "olfactory receptor, family 4, subfamily S, member 2" in scientific nomenclature. This protein is also known by several synonyms including OR4S2P, OST725, and OR11-137 . As a member of the olfactory receptor superfamily, OR4S2 belongs to the larger G protein-coupled receptor (GPCR) family, characterized by seven transmembrane domains that span the cell membrane.

The human OR4S2 protein consists of 311 amino acids in its full-length form, placing it within the typical size range for olfactory receptors . Commercially available recombinant forms of this protein often include modifications such as histidine (His) tags to facilitate purification and experimental manipulation. For instance, recombinant full-length human OR4S2 protein with His-tag is produced in Escherichia coli expression systems for research applications .

CharacteristicDetailsSource
Official Full NameOlfactory receptor, family 4, subfamily S, member 2
SynonymsOR4S2P, OST725, OR11-137
Protein LengthFull Length (1-311 amino acids)
Production HostE. coli
TagHis
Product CategoryRecombinant protein

Functional Properties and Signaling Mechanisms

Like other olfactory receptors, OR4S2 functions through G protein-coupled signal transduction pathways. The binding of an appropriate odorant molecule to the receptor triggers conformational changes that activate associated G proteins, particularly Gαolf (olfactory-specific G protein). This activation initiates a signaling cascade involving adenylyl cyclase, which increases intracellular cyclic adenosine monophosphate (cAMP) levels. The elevated cAMP opens cyclic nucleotide-gated ion channels, leading to membrane depolarization and generation of action potentials that are transmitted to the brain's olfactory bulb.

Research has documented that OR4S2 engages in direct interactions with various proteins and molecules. These interactions have been detected through multiple experimental approaches, including yeast two-hybrid systems, co-immunoprecipitation (co-IP), and pull-down assays . Such protein-protein interactions are crucial for proper receptor trafficking, membrane insertion, and signal transduction functions.

Functional analysis has revealed that OR4S2 responds to specific odorant molecules, particularly cis-3-hexenol, which contributes to "green" odors commonly found in plant materials . This specificity for particular odorant structures reflects the evolved role of olfactory receptors in discriminating between countless environmental chemicals.

Experimental Systems and Expression Methods

The functional characterization of olfactory receptors presents significant technical challenges due to their poor heterologous expression. Researchers have developed specialized systems to overcome these limitations, particularly for receptors with high basal activity like OR4S2.

In a comprehensive study of human olfactory receptors, researchers employed HEK293 cells transfected with expression vectors containing OR4S2 along with accessory proteins that enhance functional expression . The experimental system included:

  1. Co-expression with RTP1S (Receptor Transporter Protein 1S), which facilitates trafficking of olfactory receptors to the cell membrane

  2. Utilization of cAMP-responsive luciferase reporters (CRE/luc2PpGL4.29) to measure receptor activation

  3. Inclusion of control reporters (pRL-CMV) for normalization

  4. In some cases, co-expression with Gαolf to enhance signaling

The experimental protocol involved transfecting cells with approximately 0.029 μg of FLAG-Rho-tagged OR pME18S vector, 0.022 μg of CRE/luc2PpGL4.29, 0.0011 μg of pRL-CMV, and 0.012 μg of RTP1S pME18S vectors per well . This precise combination of expression vectors proved crucial for achieving functional expression and reliable measurement of receptor activity.

Odorant Response Profile and Ligand Specificity

One of the most significant findings regarding OR4S2 is its responsiveness to the odorant cis-3-hexenol. In functional screening assays, cells expressing OR4S2 showed measurable activation when stimulated with this compound . The response was concentration-dependent, indicating a specific receptor-ligand interaction rather than non-specific effects.

The identification of cis-3-hexenol as an OR4S2 ligand contributes to our understanding of the molecular basis of "green" odor perception. This compound is naturally present in various plant materials and contributes significantly to fresh, grassy odor profiles in nature and in flavoring applications.

OdorantResponse in OR4S2-Expressing CellsExperimental SystemReference
cis-3-hexenolPositive activationHEK293 cells with luciferase reporter
l-carvoneNot identified as responderHEK293 cells with luciferase reporter
d-carvoneNot identified as responderHEK293 cells with luciferase reporter
Anis aldehydeNot identified as responderHEK293 cells with luciferase reporter
Methyl β-naphthyl ketoneNot identified as responderHEK293 cells with luciferase reporter
LinaloolNot identified as responderHEK293 cells with luciferase reporter

Cell-Type Dependent Functional Expression

A particularly interesting aspect of OR4S2 research involves the differential functional expression observed across various cell types. While HEK293 cells are commonly used for heterologous expression of olfactory receptors, research has shown that different cell lines may vary in their capacity to support functional expression of specific receptors.

In comprehensive screening experiments, researchers tested OR4S2 along with other olfactory receptors in multiple cell lines, including HEK293, HepG2, HuH7, and LNCaP cells . These experiments revealed cell-type-specific patterns of functional expression, with some receptors showing robust function in one cell type but limited activity in others.

The observed cell-type dependence may reflect differences in:

  1. Endogenous G protein expression levels

  2. Membrane composition affecting receptor insertion and stability

  3. cAMP metabolism and phosphodiesterase activity

  4. Presence of auxiliary proteins that modulate receptor function

  5. Post-translational modification capabilities

Production of Recombinant OR4S2 for Research Applications

The production of recombinant OR4S2 protein provides an essential tool for various research applications. Commercial sources offer recombinant full-length human OR4S2 protein with His-tag, produced in E. coli expression systems . These recombinant proteins enable investigations that would be difficult to conduct using native receptors from tissue sources.

The availability of purified recombinant OR4S2 facilitates:

  1. Structural studies of receptor-ligand interactions

  2. Development of antibodies for detection and localization studies

  3. In vitro binding assays with potential ligands

  4. Protein-protein interaction studies

  5. Development of biosensor applications

Storage recommendations for recombinant OR4S2 products indicate that shelf life depends on multiple factors, including storage conditions, buffer composition, and handling procedures . Proper attention to these factors is essential for maintaining protein activity and experimental reliability.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific requirements for the format, please specify your needs in the order remarks. We will prepare the product according to your demand.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
OR4S2; OR4S2P; Olfactory receptor 4S2; Olfactory receptor OR11-137
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR4S2
Target Protein Sequence
MEKINNVTEFIFWGLSQSPEIEKVCFVVFSFFYIIILLGNLLIMLTVCLSNLFKSPMYFF LSFLSFVDICYSSVTAPKMIVDLLAKDKTISYVGCMLQLFGVHFFGCTEIFILTVMAYDR YVAICKPLHYMTIMNRETCNKMLLGTWVGGFLHSIIQVALVVQLPFCGPNEIDHYFCDVH PVLKLACTETYIVGVVVTANSGTIALGSFVILLISYSIILVSLRKQSAEGRRKALSTCGS HIAMVVIFFGPCTFMYMRPDTTFSEDKMVAVFYTIITPMLNPLIYTLRNAEVKNAMKKLW GRNVFLEAKGK
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15183

KEGG: hsa:219431

STRING: 9606.ENSP00000310337

UniGene: Hs.553621

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfactory Receptor 4S2 and what is its role in human olfaction?

Olfactory receptor 4S2 (OR4S2) is a protein encoded by the OR4S2 gene in humans. It belongs to the olfactory receptor family, which constitutes the largest gene family in the human genome. OR4S2 functions as a G-protein-coupled receptor (GPCR) with a characteristic 7-transmembrane domain structure shared with many neurotransmitter and hormone receptors .

Functionally, OR4S2 participates in the initial stages of olfactory signal transduction by interacting with odorant molecules in the nasal epithelium. Upon binding with specific ligands, it initiates a neuronal response cascade that ultimately leads to odor perception. Like other olfactory receptors, OR4S2 contributes to the combinatorial coding system that enables humans to distinguish thousands of different odors despite having a limited number of receptor types .

How does OR4S2 fit within the classification system of olfactory receptors?

OR4S2 is classified as part of the olfactory receptor family 4, subfamily S, member 2. This nomenclature follows the standardized system for olfactory receptors, which is independent of nomenclature used for other organisms. The OR4S2 gene is also known by several aliases including OR11-137, OR4S2P, and OST725 .

Within the broader evolutionary context, olfactory receptors are typically categorized into two main classes:

  • Class I (fish-like receptors)

  • Class II (tetrapod-specific receptors)

OR4S2 belongs to the Class II category, which expanded significantly during the evolution of land-dwelling vertebrates. This classification reflects its phylogenetic relationship to other olfactory receptors and provides insights into its evolutionary history and potential functional specialization .

What are the known genomic variations of OR4S2 and their functional implications?

OR4S2 exhibits significant genomic variability, particularly in terms of copy number variations (CNVs). Located on chromosome 11q11, OR4S2 is part of a cluster of olfactory receptor genes (including OR4C11, OR4P4, OR4V1P, and OR4P1P) that show structural polymorphism in the human population .

Genomic analysis reveals two primary structural configurations:

  • The undeleted structure (reference genome build 36.1) - present in approximately 65% of the population

  • A complex alternative structure with four deletions and some inversions (documented in fosmids AC193142 and AC210900) - present in approximately 35% of the population

OR ClusterGenomic LocationStructural VariantsPopulation FrequencyMechanism
OR4C11, OR4P4, OR4S2, OR4V1P, OR4P1P11q11Undeleted (b36.1)65%NHEJ (Non-Homologous End Joining)
OR4C11, OR4P4, OR4S2, OR4V1P, OR4P1P11q11Complex structure with four deletions and inversions35%See Figure S1 in original research

These structural variations may affect OR4S2 expression patterns and functionality, potentially contributing to individual differences in olfactory perception. The complex rearrangements observed in this region suggest that OR4S2 has been subject to dynamic evolutionary processes, likely influenced by selection pressures related to olfactory function .

How do copy number variations of OR4S2 compare to other olfactory receptor genes?

Copy number variations are particularly prevalent among olfactory receptor genes compared to other gene families. OR4S2 exemplifies this pattern as part of a genomically dynamic cluster on chromosome 11q11 .

The enrichment of CNVs in OR genes remains statistically significant even after accounting for genomic clustering of ORs. This suggests that olfactory receptors, including OR4S2, have evolutionary mechanisms that specifically promote genomic diversity beyond what would be expected by their clustered arrangement alone .

Mechanistically, the CNVs observed in the OR4S2 region appear to involve non-homologous end joining (NHEJ), which differs from the non-allelic homologous recombination (NAHR) mechanism seen in some other OR gene clusters. This distinction is notable as it suggests different mutational processes may operate on different OR gene clusters .

What are the optimal expression systems for recombinant production of functional OR4S2?

The expression of functional recombinant OR4S2 presents significant challenges common to GPCR proteins. Based on collective research on olfactory receptors, the following expression systems have proven most effective:

  • Hana3A cell line: This modified HEK293 cell line expresses chaperone proteins (RTP1, RTP2), olfactory G-protein, and rho tag, providing the cellular machinery necessary for proper OR folding and trafficking. Approximately 41% of published bioassay results for olfactory receptors utilize this system, making it the current gold standard for heterologous OR expression .

  • Alternative mammalian cell lines: Other modified cell lines such as human prostate carcinoma cells (LNCaP) have demonstrated success in identifying OR ligands that were undetectable in HEK293-based systems, highlighting the importance of cellular context .

When expressing OR4S2 recombinantly, researchers should consider:

  • Inclusion of accessory proteins (RTP1/2, REEP1) to facilitate membrane trafficking

  • N-terminal signal sequences (e.g., from rhodopsin) to enhance surface expression

  • Codon optimization for the expression system

  • Temperature modulation during expression (typically 30-33°C rather than 37°C)

  • Use of chemical chaperones to improve folding

The choice of expression system significantly impacts experimental outcomes, with assay-dependent bias established as a critical factor in OR deorphanization studies .

What are the current methodologies for assessing OR4S2-ligand interactions?

Several complementary approaches can be employed to characterize OR4S2-ligand interactions:

  • Luciferase reporter assays: The most widely used technique (41% of documented bioassays), involving co-transfection of OR4S2 with a cAMP-responsive luciferase reporter. Upon receptor activation, the cAMP signaling cascade triggers luciferase expression, providing a quantifiable readout .

  • Calcium imaging: Utilizing calcium-sensitive fluorescent dyes or genetically encoded calcium indicators to visualize receptor activation in real-time at the single-cell level.

  • Electrophysiological recordings: Patch-clamp techniques that directly measure ionic currents resulting from receptor activation, offering high temporal resolution.

  • Binding assays: Direct measurement of ligand-receptor interactions using radiolabeled or fluorescently tagged odorants, though these are technically challenging for ORs.

  • Molecular dynamics simulations: Computational approaches that model the binding pocket and ligand docking, increasingly important with advances in structural biology and computational power .

For meaningful results, researchers should consider:

  • Testing across a range of ligand concentrations to establish dose-response relationships

  • Including appropriate positive and negative controls

  • Validating findings across multiple assay types to mitigate assay-dependent bias

  • Documenting non-responsive experiments as these provide valuable negative data

How can the binding pocket of OR4S2 be characterized in the absence of crystal structures?

Despite the absence of crystal structures for OR4S2, several approaches can be employed to characterize its binding pocket:

  • Homology modeling: Constructing structural models based on closely related GPCRs with resolved structures. Recent advances in cryo-electron microscopy have provided structures for some olfactory receptors, which can serve as improved templates .

  • Site-directed mutagenesis: Systematically altering amino acids predicted to line the binding pocket and measuring the effect on ligand response profiles. This approach can identify residues critical for ligand recognition and selectivity.

  • Molecular dynamics simulations: Computational approaches that model protein flexibility and ligand interactions over time. These simulations can predict:

    • Binding pocket conformational changes

    • Ligand entry/exit pathways

    • Energetics of ligand-receptor interactions

    • Effects of mutations on binding affinity

  • Chimeric receptor analysis: Creating hybrid receptors with segments from related ORs to identify domains responsible for ligand specificity.

  • Cross-species comparative analysis: Examining functional differences between OR4S2 orthologs from different species to identify evolutionarily conserved binding residues.

The combination of these approaches can generate testable hypotheses about the structural determinants of OR4S2 ligand specificity, even in the absence of direct structural data .

What is known about the ligand specificity profile of OR4S2?

When investigating the ligand profile of OR4S2, researchers should consider:

  • Structural diversity: Testing compounds with varied chemical scaffolds to identify pharmacophore features that correlate with activity.

  • Stereoselectivity: Examining responses to enantiomers and diastereomers, as some ORs (e.g., OR1A1) show differential responses to stereoisomers .

  • Concentration-dependence: Evaluating responses across a range of concentrations, as olfactory perception and receptor activation are highly concentration-dependent. A molecule may not elicit response at low concentrations but become an agonist at higher concentrations .

  • Context effects: Testing in the presence of other odorants to identify potential synergistic or antagonistic effects that may modulate receptor response.

  • Species differences: Comparing ligand responses between human OR4S2 and orthologs from other species to understand evolutionary trends in specificity.

To systematically characterize OR4S2 specificity, high-throughput screening approaches coupled with computational predictions represent the most efficient strategy for identifying potential ligands from large chemical libraries .

How can computational approaches enhance OR4S2 research?

Computational methodologies have become increasingly valuable for advancing OR4S2 research, particularly given the experimental challenges associated with olfactory receptors:

  • Machine learning models: Training predictive algorithms on existing OR-ligand interaction data (such as that contained in the M2OR database) can generate hypotheses about OR4S2 ligand preferences based on chemical features and patterns observed across the olfactory receptor family .

  • Molecular dynamics simulations: Advanced simulation techniques can model:

    • Receptor conformational changes during activation

    • Ligand binding/unbinding pathways

    • Interactions with G-proteins and other downstream effectors

    • Effects of mutations or polymorphisms on receptor function

  • Network analysis: Examining OR4S2 within the broader context of the olfactory receptor network can reveal functional relationships between receptors and identify patterns of co-expression or co-activation that inform its biological role.

  • Evolutionary analysis: Computational phylogenetics can trace the evolutionary history of OR4S2, identifying selective pressures and functional shifts that have shaped its current properties.

  • Integration with -omics data: Correlating OR4S2 genetic variation with transcriptomic, proteomic, or metabolomic datasets can uncover broader biological contexts for this receptor's function.

The most promising computational approach combines multiple methods with experimental validation in an iterative cycle, where computational predictions guide experimental design, and experimental results refine computational models .

What are the challenges and potential solutions for studying OR4S2 in native olfactory sensory neurons?

Studying OR4S2 in its native cellular context presents unique challenges but offers insights that cannot be obtained from heterologous systems. Key challenges and methodological solutions include:

  • Cellular rarity: Each olfactory sensory neuron (OSN) typically expresses only one OR allele, making OR4S2-expressing neurons rare within the olfactory epithelium. This challenge can be addressed through:

    • Single-cell RNA sequencing to identify OR4S2-expressing neurons

    • Development of OR4S2-specific antibodies for immunohistochemical identification

    • Creation of reporter mouse models with fluorescent tags linked to the OR4S2 promoter

  • Functional heterogeneity: Native OSNs may show different response properties compared to heterologous systems due to the presence of the complete signaling machinery. Researchers can leverage:

    • Calcium imaging of dissociated OSNs

    • Patch-clamp electrophysiology of identified OR4S2-expressing neurons

    • In vivo imaging using multiphoton microscopy in animal models

  • Human tissue accessibility: Limited access to human olfactory tissue necessitates alternative approaches:

    • Use of cadaveric tissue with rapid post-mortem collection

    • Nasal biopsies from living donors

    • Differentiation of human induced pluripotent stem cells (iPSCs) into olfactory neurons

  • Technical considerations: Maintaining viable olfactory tissue requires specialized methods:

    • Optimized dissociation protocols to preserve cellular integrity

    • Appropriate culture conditions to maintain OSN phenotype

    • Rapid functional assessment to accommodate the limited lifespan of primary OSNs

Despite these challenges, studies in native OSNs provide crucial validation of findings from heterologous systems and can reveal aspects of OR4S2 function that emerge only in the complete cellular context .

How can OR4S2 research contribute to understanding human olfactory perception variability?

OR4S2 research offers valuable insights into the genetic basis of individual differences in olfactory perception:

  • Copy number variation analysis: The documented copy number variations of OR4S2 (present in undeleted form in 65% of the population with complex structural variants in the remaining 35%) may correlate with specific olfactory phenotypes . Researchers can:

    • Conduct association studies between OR4S2 CNVs and odor detection thresholds

    • Analyze perception intensity ratings for OR4S2 ligands across genotyped populations

    • Investigate specific anosmias (inability to smell certain odorants) in relation to OR4S2 variants

  • Functional characterization of polymorphisms: Beyond copy number, single nucleotide polymorphisms in OR4S2 may alter ligand specificity or sensitivity. Researchers should:

    • Express variant forms of OR4S2 in heterologous systems

    • Compare dose-response relationships for key ligands

    • Model structural consequences of amino acid substitutions

  • Integration with psychophysical data: Connecting molecular function to perceptual experience requires:

    • Carefully designed psychophysical testing with controlled stimuli

    • Large cohorts with genetic characterization

    • Statistical methods that account for the complex genetic architecture of olfaction

  • Environmental interactions: OR4S2 expression and function may be modulated by environmental factors, suggesting research directions including:

    • Epigenetic analysis of OR4S2 regulation

    • Investigation of inflammatory effects on receptor expression

    • Studies of exposure-dependent sensitivity changes

This integrative approach can help elucidate how molecular variations in OR4S2 contribute to the remarkable diversity of human olfactory perception .

What are the methodological considerations for investigating OR4S2 in the context of olfactory disorders?

Investigating OR4S2 in olfactory disorders requires specialized methodological approaches:

  • Clinical phenotyping: Precise characterization of olfactory dysfunction is essential for meaningful correlations with OR4S2 variations:

    • Standardized olfactory testing (e.g., UPSIT, Sniffin' Sticks)

    • Odor-specific threshold testing for putative OR4S2 ligands

    • Detailed clinical history to distinguish congenital from acquired anosmia

  • Genetic analysis approaches:

    • Targeted sequencing of OR4S2 in patient cohorts

    • Custom array CGH (comparative genomic hybridization) to detect copy number variations

    • Whole genome sequencing to identify structural variants affecting OR4S2

  • Functional validation strategies:

    • In vitro expression of patient-derived OR4S2 variants

    • Calcium imaging or luciferase assays to assess functional consequences

    • Molecular dynamics simulations to predict structural impacts of mutations

  • Tissue analysis methods (for acquired disorders):

    • Immunohistochemistry to assess OR4S2 expression in biopsy samples

    • Single-cell RNA sequencing to examine transcriptional changes

    • Proteomics to identify post-translational modifications affecting function

  • Longitudinal study design considerations:

    • Repeated assessments to track progression or recovery

    • Correlation with environmental exposures or inflammatory biomarkers

    • Treatment response monitoring in relation to OR4S2 genotype

These methodological approaches enable researchers to establish whether OR4S2 variations contribute to specific olfactory disorders or could serve as genetic markers for particular types of dysfunction .

How can researchers effectively utilize the M2OR database for OR4S2 investigations?

The Molecule to Olfactory Receptor (M2OR) database represents a valuable resource for OR4S2 research, containing curated data on OR-molecule interactions from 42 scientific articles. Researchers can maximize its utility through the following approaches:

  • Specialized query strategies:

    • Search for molecules tested against OR4S2 specifically

    • Identify ligands of phylogenetically related receptors that may cross-react with OR4S2

    • Compare response profiles across different experimental conditions

  • Leveraging negative data: Unlike many repositories, M2OR contains information on non-responsive OR-molecule pairs, which is crucial for understanding receptor specificity:

    • Analyze compounds tested against OR4S2 that showed no activity

    • Identify structural features that distinguish active from inactive compounds

    • Use negative data to refine computational models of ligand binding

  • Experimental design guidance:

    • Reference previously used concentration ranges for testing

    • Adopt validated experimental protocols documented in the database

    • Select appropriate cell lines based on successful prior assays

  • Comparative analysis techniques:

    • Compare OR4S2 with other olfactory receptors that share similar ligand profiles

    • Examine responses to enantiomers and other stereoisomers

    • Analyze concentration-dependent responses across multiple receptors

  • Data integration approaches:

    • Export raw data for custom computational analysis

    • Combine with structural data for modeling studies

    • Correlate with expression data from other databases

The M2OR database provides unprecedented access to 25 years of OR-molecule bioassay results, offering a comprehensive foundation for designing and interpreting OR4S2 experiments .

What bioinformatic pipelines are recommended for analyzing OR4S2 genomic and functional data?

Several specialized bioinformatic approaches are recommended for comprehensive analysis of OR4S2 data:

  • Genomic structural variation analysis:

    • Long-read sequencing analysis (PacBio or Oxford Nanopore) to resolve complex structural variants

    • Custom pipeline for detection of copy number variations (CNVs) in OR gene clusters

    • Simulation-based statistical assessment to determine significance of OR4S2 structural variants

  • Sequence analysis workflows:

    • Multiple sequence alignment of OR4S2 with related receptors

    • Evolutionary rate analysis to identify functionally constrained regions

    • Prediction of post-translational modification sites

  • Transcriptomic data processing:

    • Single-cell RNA-seq analysis to identify co-expression patterns

    • Differential expression analysis in various physiological states

    • Alternative splicing detection for potential OR4S2 isoforms

  • Structural bioinformatics approaches:

    • Homology modeling using recently solved OR structures as templates

    • Molecular docking of candidate ligands

    • Molecular dynamics simulation analysis

  • Functional data integration:

    • Machine learning models that incorporate diverse experimental results

    • Network analysis connecting OR4S2 to downstream signaling pathways

    • Systems biology approaches linking receptor activity to perceptual outcomes

When implementing these pipelines, researchers should consider:

  • Appropriate controls for batch effects and technical variability

  • Careful parameter optimization for OR-specific analyses

  • Integration of multiple data types through statistical frameworks

  • Validation of computational predictions through targeted experiments

What emerging technologies hold promise for advancing OR4S2 research?

Several cutting-edge technologies are poised to transform OR4S2 research in the coming years:

  • Cryo-electron microscopy: Recent breakthroughs in resolving GPCR structures using cryo-EM offer the potential to determine the structure of OR4S2, providing unprecedented insights into its binding pocket and activation mechanisms .

  • AlphaFold and related AI structure prediction tools: These platforms have demonstrated remarkable accuracy in predicting protein structures and could generate high-confidence models of OR4S2 even in the absence of experimental structures.

  • Single-molecule techniques: Methods such as:

    • Single-molecule FRET to observe conformational changes during activation

    • Single-molecule force spectroscopy to measure ligand binding energetics

    • Super-resolution microscopy to visualize receptor clustering and trafficking

  • Organ-on-a-chip technology: Microfluidic systems that recapitulate the olfactory epithelium microenvironment, enabling:

    • Controlled exposure to volatile odorants

    • Integration of multiple cell types in physiologically relevant arrangements

    • Long-term culture for chronic exposure studies

  • CRISPR-based approaches:

    • Precise genome editing to create labeled OR4S2 variants

    • CRISPRi/CRISPRa for controlled modulation of expression

    • Base editing to introduce specific mutations for structure-function studies

  • Novel biosensor platforms:

    • Cell-free expression systems coupled with receptor-derived sensing elements

    • Nanobody-based detectors for conformational states

    • Miniaturized, multiplexed assay platforms for high-throughput screening

These technological advances promise to overcome longstanding challenges in OR4S2 research, particularly relating to structural characterization, native context studies, and high-throughput functional analysis .

How might OR4S2 research contribute to broader understanding of GPCR biology and drug development?

OR4S2 research has significant implications beyond olfaction, potentially informing broader aspects of GPCR biology and drug development:

  • Ligand promiscuity insights: Olfactory receptors like OR4S2 recognize diverse chemical structures with varying affinities. Understanding the molecular basis of this promiscuity could:

    • Reveal general principles of GPCR-ligand interactions

    • Inform design of multi-target drugs with optimized polypharmacology

    • Improve prediction of off-target effects for drug candidates

  • Structural plasticity mechanisms: OR4S2 likely exhibits substantial conformational flexibility to accommodate diverse ligands. Characterizing this plasticity may:

    • Identify novel activation mechanisms applicable to other GPCRs

    • Suggest strategies for designing drugs that stabilize specific conformational states

    • Reveal the molecular basis of biased signaling

  • Evolution of specificity: The evolutionary pressures that have shaped OR4S2 specificity differ from those acting on other GPCRs, providing a comparative framework to understand:

    • How receptor binding pockets evolve under different selective pressures

    • The structural basis of ligand discrimination

    • Mechanisms of functional diversification within receptor families

  • Copy number variation significance: The documented CNVs affecting OR4S2 may provide insights into:

    • Functional consequences of GPCR gene dosage alterations

    • Adaptive significance of receptor repertoire diversity

    • Genomic mechanisms driving receptor gene family evolution

  • Heterologous expression solutions: Techniques developed to express functional OR4S2 could address similar challenges with other difficult-to-express GPCRs, facilitating:

    • Structural studies of pharmacologically important receptors

    • Development of cell-based assays for drug screening

    • Production of purified receptors for biophysical characterization

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.