Recombinant Human Olfactory receptor 4X1 (OR4X1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice for shipping, please inform us in advance as an additional fee will be incurred.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us and we will prioritize its inclusion in development.
Synonyms
OR4X1; Olfactory receptor 4X1; Olfactory receptor OR11-104
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR4X1
Target Protein Sequence
MVATNNVTEIIFVGFSQNWSEQRVISVMFLLMYTAVVLGNGLIVVTILASKVLTSPMYFF LSYLSFVEICYCSVMAPKLIFDSFIKRKVISLKGCLTQMFSLHFFGGTEAFLLMVMAYDR YVAICKPLHYMAIMNQRMCGLLVRIAWGGGLLHSVGQTFLIFQLPFCGPNIMDHYFCDVH PVLELACADTFFISLLIITNGGSISVVSFFVLMASYLIILHFLRSHNLEGQHKALSTCAS HVTVVDLFFIPCSLVYIRPCVTLPADKIVAVFYTVVTPLLNPVIYSFRNAEVKNAMRRFI GGKVI
Uniprot No.

Target Background

Function
Odorant receptor.
Gene References Into Functions
  1. A study identified a novel non-synonymous single nucleotide polymorphism (nSNP) in the OR4X1 gene (rs10838851, Tyr273Ter*), showing a significant association with FEV1.0/FVC values in pulmonary function tests within a Japanese population. PMID: 17964544
  2. This study represents an observational analysis of gene-disease association. (HuGE Navigator) PMID: 17964544
Database Links

HGNC: 14854

KEGG: hsa:390113

STRING: 9606.ENSP00000321506

UniGene: Hs.553742

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR4X1 and what is its primary function?

OR4X1 (Olfactory receptor family 4 subfamily X member 1, also known as OR11-104) is a member of the olfactory receptor family, which constitutes the largest gene family in the human genome. OR4X1 functions as a G-protein-coupled receptor (GPCR) with a characteristic 7-transmembrane domain structure that facilitates odorant signal transduction. Like other olfactory receptors, OR4X1 interacts with specific odorant molecules in the nasal epithelium to initiate neuronal responses that ultimately trigger smell perception. The signaling cascade involves G protein-mediated pathways that translate chemical recognition into electrical signals interpretable by the brain . Interestingly, OR4X1 represents a segregating pseudogene in humans, meaning some individuals possess functional alleles while others have non-functional variants, contributing to individual differences in olfactory perception .

What is the genomic context and structure of the OR4X1 gene?

OR4X1 is located on chromosome 11 at position 11p11.2, specifically spanning nucleotides 48,263,861 to 48,264,778 on reference sequence NC_000011.10. Unlike many protein-coding genes, OR4X1 consists of a single exon, which is characteristic of the olfactory receptor gene family. This single-exon structure facilitates direct translation without splicing requirements, potentially enabling more efficient expression in specialized olfactory neurons . Researchers investigating the gene structure should note that OR4X1's status as a segregating pseudogene means expression and functionality may vary significantly between individuals, necessitating careful subject selection and genetic screening in experimental designs .

What expression patterns does OR4X1 exhibit across different tissues?

While historically olfactory receptors were thought to be exclusively expressed in nasal olfactory epithelium, mounting evidence suggests OR4X1, like many other olfactory receptors, exhibits ectopic expression across multiple tissue types. This phenomenon indicates potential functions beyond traditional olfaction. Research has demonstrated that olfactory receptors can serve diverse physiological roles in non-olfactory tissues, including cellular proliferation, migration, and specialized metabolic functions . For researchers examining OR4X1 expression, quantitative RT-PCR remains the gold standard for detecting tissue-specific expression levels, with RNA-seq and microarray analysis offering complementary approaches for broader transcriptomic profiling. When investigating protein expression, immunohistochemistry using validated antibodies specific to OR4X1 provides spatial resolution within tissues, though this approach requires careful optimization due to the typically low expression levels of ectopic olfactory receptors .

What are the optimal methods for expressing recombinant OR4X1 protein?

Successful expression of functional recombinant OR4X1 presents significant technical challenges due to its hydrophobic transmembrane domains. Different expression systems offer varying advantages for OR4X1 production, as summarized in Table 1:

Expression SystemAdvantagesLimitationsOptimal TagsApplications
E. coliHigh yield, cost-effective, rapid productionLimited post-translational modifications, inclusion body formationHis-tag, MBP fusionStructural studies, antibody production
YeastBetter folding than E. coli, some post-translational modificationsLower yield than E. coliHis-tagFunctional studies, protein-protein interactions
BaculovirusHigh expression levels, advanced post-translational modificationsMore complex system, longer production timeHis-tag, Flag-tagFunctional assays, structural studies
Mammalian cellsNatural post-translational modifications, proper foldingLower yields, higher costHis-tag, Flag-tag, Avi-tag BiotinylatedSignaling studies, ligand binding assays

For OR4X1 specifically, mammalian expression systems may provide the most physiologically relevant protein conformation, though yields remain challenging. The Avi-tag Biotinylated approach involves in vivo biotinylation via E. coli biotin ligase (BirA), which catalyzes the formation of an amide linkage between biotin and a specific lysine residue in the 15-amino acid AviTag peptide, providing excellent utility for downstream applications like pull-down assays and binding studies . Regardless of the expression system chosen, researchers should optimize codon usage for the host organism and consider incorporating chaperon co-expression strategies to enhance proper folding of this complex transmembrane protein .

What methodological approaches are effective for studying OR4X1's ligand binding properties?

Investigating the ligand binding properties of OR4X1 requires specialized techniques to overcome the challenges associated with transmembrane receptors. Several complementary methodologies can be employed:

The segregating pseudogene status of OR4X1 necessitates genetic screening of any cell lines used for functional studies to ensure expression of the functional allele variant .

How can researchers investigate the potential non-olfactory functions of OR4X1?

Exploring the non-canonical functions of OR4X1 in non-olfactory tissues requires multidisciplinary approaches to connect receptor activation with downstream physiological effects. Based on methodologies used for other ectopically expressed olfactory receptors, researchers should consider:

  • Gene silencing experiments using siRNA or CRISPR-Cas9 targeting OR4X1 in tissues of interest, followed by phenotypic assays examining cellular proliferation, migration, or metabolic parameters. This approach has revealed functional roles for other olfactory receptors, such as OR51E2's inhibitory effects on melanoma cell proliferation and migration .

  • Overexpression studies in relevant cell lines, coupled with pathway analysis using phosphorylation-specific antibodies to elucidate signaling cascades. Previous research with olfactory receptors has identified activation of multiple signaling pathways, including cAMP/PKA, MAPK, AKT, and calcium-dependent mechanisms .

  • Transcriptomic analysis comparing OR4X1-silenced and control cells can identify downstream gene expression changes, revealing potential transcriptional networks regulated by this receptor. RNA-seq offers comprehensive coverage for such investigations .

  • Immunoprecipitation followed by mass spectrometry can identify OR4X1 protein interaction partners in non-olfactory tissues, providing insights into its molecular function beyond traditional G protein coupling .

When designing these experiments, researchers should consider tissue-specific G protein expression profiles, as ectopic olfactory receptors may couple with different G proteins depending on the cellular context .

What techniques are available for studying genetic variants of OR4X1?

Given OR4X1's status as a segregating pseudogene, analyzing its genetic variation is particularly relevant for understanding functional differences between populations. Several techniques offer complementary approaches:

  • Next-generation sequencing (NGS) provides comprehensive identification of OR4X1 variants across populations. Whole-exome or targeted sequencing can efficiently capture the single-exon OR4X1 gene. Analysis should focus on variants affecting the protein's transmembrane domains and potential ligand-binding regions .

  • Functional characterization of variants can be accomplished through heterologous expression systems combined with calcium imaging or cAMP assays to compare signaling properties between variants. This approach can distinguish functional from non-functional alleles .

  • CRISPR-based genome editing enables introducing specific OR4X1 variants into cellular models for functional studies. This approach allows direct comparison of variant effects in identical genetic backgrounds .

  • Population genetics analysis utilizing resources like the Variation Viewer for OR4X1 variants from NCBI can reveal evolutionary patterns and selective pressures acting on this gene. Researchers should examine allele frequencies across different populations to identify potential adaptive signatures .

The ClinVar and dbVar databases contain reported variants for OR4X1, providing a starting point for researchers investigating the clinical and functional significance of these genetic variations .

What are the optimal storage and handling conditions for recombinant OR4X1 protein?

Maintaining the stability and functionality of recombinant OR4X1 protein requires careful attention to storage and handling procedures. Based on established protocols for similar transmembrane proteins:

  • Lyophilized OR4X1 protein powder should be briefly centrifuged before opening to ensure the material is collected at the bottom of the vial. Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being optimal for many applications) and aliquot the protein solution to minimize freeze-thaw cycles. Storage at -20°C/-80°C is essential for maintaining protein integrity .

  • When planning experiments, researchers should account for the protein's shelf life, which depends on multiple factors including storage state, buffer composition, temperature, and the intrinsic stability of OR4X1. Quality control testing using SDS-PAGE to verify >85% purity is advisable before experimental use .

  • For functional studies, consideration of the protein tag is essential, as different tags may affect protein folding, stability, and activity. The tag type can be selected during the manufacturing process based on experimental requirements, with options including His-tags for purification, fluorescent tags for localization studies, or specialized tags like Avi-tag for biotinylation .

By following these specific handling protocols, researchers can maximize the utility of recombinant OR4X1 for applications ranging from structural studies to functional assays .

How can OR4X1 research contribute to our understanding of olfactory perception variations?

The segregating pseudogene status of OR4X1 presents a unique opportunity to investigate the genetic basis of individual variations in olfactory perception. By correlating OR4X1 genotypes with phenotypic outcomes in olfactory perception tests, researchers can directly link genetic variation to functional differences in smell sensitivity or specificity . This approach requires coordinated genotyping of the OR4X1 locus and standardized psychophysical testing of olfactory thresholds for potential OR4X1 ligands. Statistical methods such as genome-wide association studies (GWAS) or targeted genotype-phenotype correlations can establish meaningful connections between specific OR4X1 variants and perceptual outcomes .

Furthermore, the evolutionary implications of maintaining a segregating pseudogene within the human population warrant investigation. Comparative genomic approaches examining OR4X1 across different human populations and closely related primates could reveal selective pressures and potential adaptive advantages of functional versus non-functional variants in different environments or dietary contexts . These studies have broader implications for understanding the evolution of sensory perception in humans and the genetic architecture underlying individual differences in olfactory capabilities.

What is the significance of OR4X1 in comparative olfactory genomics?

OR4X1 can serve as a model for investigating evolutionary patterns in olfactory receptor genes across species. Comparative genomic analyses of OR4X1 orthologs in different mammalian species can reveal evolutionary conservation or divergence patterns, providing insights into the selective pressures acting on this receptor throughout evolutionary history . Researchers should apply phylogenetic analysis methods to OR4X1 sequences from diverse mammalian genomes, focusing on rates of synonymous versus non-synonymous substitutions to identify regions under positive or purifying selection.

The segregating pseudogene status of human OR4X1 is particularly interesting from an evolutionary perspective, as it represents a gene in transition – potentially being lost in humans while remaining functional in other species. This evolutionary "snapshot" offers a unique window into the dynamic processes shaping the mammalian olfactory receptor repertoire . Cross-species functional studies comparing the ligand binding properties of OR4X1 orthologs could reveal how receptor specificity evolves in response to different ecological niches and olfactory requirements. Such research has implications beyond olfaction, potentially illuminating general principles of sensory receptor evolution and adaptation.

How might OR4X1 be involved in disease mechanisms or pathophysiology?

Emerging evidence suggests ectopically expressed olfactory receptors may contribute to various pathophysiological processes. While specific roles for OR4X1 remain to be established, research on other olfactory receptors provides potential models for investigation. For example, OR51E2 has demonstrated involvement in melanoma cell proliferation and migration, suggesting tumor-suppressive properties . Similar approaches could be applied to investigate potential roles of OR4X1 in disease contexts.

Researchers should consider several methodological approaches:

  • Expression analysis comparing OR4X1 levels between normal and diseased tissues using quantitative PCR, RNA-seq, or protein immunodetection methods.

  • Functional studies manipulating OR4X1 expression (through overexpression or knockdown) in relevant cell models, followed by assessment of disease-related phenotypes.

  • Identification of OR4X1 ligands that occur endogenously in tissues expressing this receptor, potentially revealing physiological signaling pathways relevant to disease.

  • Genetic association studies examining correlations between OR4X1 variants and disease susceptibility or progression .

The potential involvement of OR4X1 in immunological processes is particularly intriguing, as other olfactory receptors have shown interactions with immune cells. For instance, OR51E2 has been identified as a tumor-associated antigen recognized by CD8+ T cells, suggesting potential applications in cancer immunotherapy .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.