Recombinant Human Olfactory receptor 4X2 (OR4X2)

Shipped with Ice Packs
In Stock

Description

Recombinant Production Methods

Recombinant OR4X2 is typically synthesized using heterologous expression systems. While direct protocols for OR4X2 are not explicitly documented, production strategies for homologous receptors (e.g., OR4Q2) provide insights:

  • Expression Systems: HEK293 or Hana3A cells, often co-expressed with chaperones (RTP1/2) to enhance membrane localization .

  • Tags: Commonly fused with Rho or FLAG tags for purification and detection .

  • Purification: Affinity chromatography followed by size-exclusion chromatography .

Functional and Ligand-Binding Insights

OR4X2’s ligand specificity remains uncharacterized, but comparative studies of olfactory receptors suggest:

  • Ligand diversity: Odorant receptors typically recognize structurally related molecules (e.g., aldehydes, esters) .

  • Activation mechanism: Odorant binding induces conformational changes, activating Gα<sub>olf</sub> proteins and cAMP signaling .

Table 1: Predicted Functional Properties

FeatureDetail
Ligand classLikely small hydrophobic molecules (inferred from GPCR homology)
Signal transductioncAMP pathway via Gα<sub>olf</sub> coupling
Tissue expressionPrimarily olfactory epithelium; low levels detected in testes (shared with other ORs)

Antibody Development

  • Anti-OR4X2 antibodies (e.g., Abbexa Ltd.’s product #abx392) are used in Western blot (WB) and ELISA to study receptor localization and expression .

  • Applications include immunohistochemistry in olfactory and reproductive tissues .

Deorphanization Efforts

OR4X2 is classified as an "orphan receptor" due to unverified ligands. Current strategies for deorphanization involve:

  • High-throughput screening using luciferase assays .

  • Calcium imaging in heterologous cells .

Challenges and Future Directions

  • Low native expression: OR4X2’s limited abundance in tissues complicates isolation .

  • Ligand identification: Requires integration with databases like M2OR, which catalogs 51,395 OR-odorant pairs .

  • Functional validation: In vivo studies are needed to confirm physiological roles beyond olfaction (e.g., sperm chemotaxis) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
OR4X2; Olfactory receptor 4X2; Olfactory receptor OR11-105
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR4X2
Target Protein Sequence
MTEFIFLVLSPNQEVQRVCFVIFLFLYTAIVLGNFLIVLTVMTSRSLGSPMYFFLSYLSF MEICYSSATAPKLISDLLAERKVISWWGCMAQLFFLHFFGGTEIFLLTVMAYDHYVAICK PLSYTTIMNWQVCTVLVGIAWVGGFMHSFAQILLIFHLLFCGPNVINHYFCDLVPLLKLA CSDTFLIGLLIVANGGTLSVISFGVLLASYMVILLHLRTWSSEGWCKALSTCGSHFAVVI LFFGPCVFNSLRPSTTLPIDKMVAVFYTVITAILNPVIYSLRNAEMRKAMKRLWIRTLRL NEK
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15184

KEGG: hsa:119764

STRING: 9606.ENSP00000307751

UniGene: Hs.553565

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR4X2 and where is it located in the human genome?

OR4X2 is a member of the olfactory receptor family, which belongs to the G-protein coupled receptor (GPCR) superfamily. The OR4X2 gene is located on chromosome 11p11.2 in the human genome . Olfactory receptors function by detecting odor molecules in the nasal epithelium and initiating sensory neuron signals to the brain. While traditionally associated with olfaction, these receptors have increasingly been found in non-olfactory tissues, suggesting broader physiological roles.

How does OR4X2 compare structurally to other characterized olfactory receptors?

Like other olfactory receptors, OR4X2 has a seven-transmembrane domain structure characteristic of GPCRs. While the specific structure of OR4X2 has not been fully characterized in the provided search results, studies of other olfactory receptors like OR17-40 provide a framework for understanding. Olfactory receptors typically contain an extracellular N-terminus, seven transmembrane domains, and an intracellular C-terminus involved in G-protein signaling . The binding pocket for odorants is generally formed by the transmembrane domains.

What are the optimal expression systems for studying recombinant OR4X2?

Based on successful methodologies with other olfactory receptors, the following expression systems are recommended for OR4X2 studies:

Human Embryonic Kidney 293 (HEK293) cells: This heterologous system has proven effective for functional expression of human olfactory receptors . For OR4X2 expression:

  • Transfect HEK293 cells with a plasmid containing the OR4X2 coding sequence

  • Use either stable or transient transfection methods depending on experimental needs

  • Consider co-expression with accessory proteins that enhance surface expression of olfactory receptors

Xenopus laevis oocytes: This system allows electrophysiological measurements of receptor function :

  • Inject oocytes with cRNA of OR4X2

  • Consider co-expression with "reporter" channels to measure responses

  • Use two-electrode voltage clamp for functional measurements

How can I validate successful expression of recombinant OR4X2?

Multiple validation methods should be employed:

Validation MethodProcedureExpected Result
RT-PCRExtract RNA from transfected cells, perform reverse transcription and PCR using OR4X2-specific primersDetection of OR4X2 transcript
ImmunocytochemistryUse specific antibodies against OR4X2 or epitope tags (if incorporated)Visualization of OR4X2 protein expression and localization
Calcium imagingLoad cells with calcium-sensitive dyes and monitor [Ca²⁺] changes upon stimulationTransient increase in intracellular [Ca²⁺] when receptor is activated by ligands
Western blottingPrepare protein lysates and probe with OR4X2-specific antibodiesDetection of OR4X2 protein band at expected molecular weight

For additional validation, consider using tagged versions of OR4X2 (e.g., with rhodopsin tag) to facilitate detection with commercially available antibodies, as has been done with other olfactory receptors .

What is the recommended methodology for identifying ligands that activate OR4X2?

A systematic approach similar to that used for OR17-40 is recommended :

  • Initial screening with odorant mixtures:

    • Prepare mixtures of potential odorants (e.g., Henkel 100 or similar commercially available mixtures)

    • Measure calcium responses or other functional readouts in OR4X2-expressing cells

    • Identify mixtures that produce positive responses

  • Deconvolution of active mixtures:

    • Subdivide active mixtures into progressively smaller groups

    • Test each subgroup until individual active compounds are identified

    • Confirm with dose-response experiments using purified compounds

  • Structure-activity relationship analysis:

    • Test structurally related molecules to the identified ligands

    • Determine molecular features required for receptor activation

    • Create a pharmacological profile of the receptor

What control experiments are essential when conducting functional studies with OR4X2?

When designing experiments to study OR4X2 function, include the following controls:

  • Mock-transfected cells: Cells transfected with empty vector to control for non-specific responses

  • Cells expressing unrelated receptors: To distinguish OR4X2-specific responses from general cellular responses

  • Concentration gradients: Test putative ligands at multiple concentrations to establish dose-response relationships

  • Structurally similar compounds: Include these to establish specificity of receptor-ligand interactions

  • Positive controls: Include known GPCR activators (if OR4X2 ligands are unknown) to validate assay functionality

What is the evidence for OR4X2 involvement in hereditary diseases?

OR4X2 has been implicated in hereditary diseases, as evidenced by the existence of clinical genetic tests targeting this gene . While specific disease associations are not fully detailed in the search results, there is indication that:

  • The gene is tested in the context of hereditary disease diagnosis

  • OR4X2 has been included among risk factor genes studied in patients with dystonia

The clinical genetic test for OR4X2 utilizes next-generation sequencing (NGS) and massively parallel sequencing (MPS) for both sequence analysis of the entire coding region and deletion/duplication analysis .

How can OR4X2 expression be detected in tissue samples for biomarker studies?

Based on methodologies used for other olfactory receptors in tissue samples :

  • Transcript detection:

    • Extract RNA from tissue samples

    • Perform RT-PCR with OR4X2-specific primers

    • Consider using exon-spanning primers to detect potential fusion transcripts

    • Validate with next-generation sequencing (NGS) and analyze read distribution using tools like IGV (Integrative Genomics Viewer)

  • Protein detection:

    • Perform immunohistochemical staining using specific antibodies against OR4X2

    • Include appropriate positive and negative controls

    • Validate antibody specificity using OR4X2-transfected cells as positive controls and non-transfected cells as negative controls

  • Analysis of fusion transcripts:

    • Design primers that span potential fusion junctions with nearby genes

    • Perform RT-PCR to detect novel fusion transcripts

    • Sequence amplicons to confirm the identity of fusion products

How should I design a comprehensive experiment to characterize OR4X2 function?

A well-designed experiment should include the following components:

ComponentDescriptionConsiderations
HypothesisClear statement of expected OR4X2 function or propertyBased on bioinformatic analysis and related receptor data
Independent VariableFactor manipulated in the experiment (e.g., ligand concentration, OR4X2 variants)Include multiple levels with appropriate range
Dependent VariableMeasured outcome (e.g., calcium flux, cAMP levels)Ensure reliable, quantifiable measurement methods
Control GroupsMock-transfected cells, cells expressing unrelated receptorsEssential for distinguishing specific from non-specific effects
Controlled VariablesTemperature, pH, cell density, expression levelsMaintain consistency across experimental conditions
Number of TrialsMinimum 3 independent experimentsEnsure statistical power through adequate replication
Data CollectionAppropriate measuring instruments and recording methodsPlan for both qualitative and quantitative data as needed

Create detailed tables for data collection that include columns for all independent and dependent variables, with clear labels and units of measurement .

What are the potential challenges in studying OR4X2 and how can they be addressed?

Several challenges are common when studying olfactory receptors like OR4X2:

  • Low surface expression:

    • Solution: Co-express with receptor trafficking proteins like RTP1, RTP2, REEP1, or Ric-8B

    • Add N-terminal signal sequences or C-terminal ER export signals

  • Functional validation without known ligands:

    • Solution: Use systematic screening approaches with diverse odorant libraries

    • Consider computational prediction of potential ligands based on receptor structure

  • Distinguishing physiological from artifactual responses:

    • Solution: Include multiple controls and validation methods

    • Confirm findings across different expression systems

  • Detecting low expression levels in non-olfactory tissues:

    • Solution: Use highly sensitive methods like qRT-PCR or digital PCR

    • Consider enrichment techniques before analysis

How can I investigate potential OR4X2 fusion transcripts in disease states?

Fusion transcripts involving olfactory receptors have been detected in disease states such as breast cancer . To investigate potential OR4X2 fusion transcripts:

  • NGS analysis:

    • Perform RNA sequencing of tissue samples

    • Analyze read distribution around the OR4X2 locus

    • Look for splice junctions connecting OR4X2 to other genes

  • RT-PCR validation:

    • Design exon-spanning primers between OR4X2 and potential partner genes

    • Perform RT-PCR on tissue samples

    • Sequence amplicons to confirm fusion junctions

  • Functional characterization:

    • Clone identified fusion transcripts into expression vectors

    • Express in appropriate cell models

    • Evaluate functional consequences compared to wild-type OR4X2

The discovery of a fusion transcript between another olfactory receptor and HIST1H2BO in breast carcinoma suggests that similar investigations for OR4X2 could be valuable.

What approaches can be used to study OR4X2 in the context of neurological disorders like dystonia?

Given the association of OR4X2 with dystonia research , the following approaches are recommended:

  • Genetic association studies:

    • Sequence OR4X2 in dystonia patients and controls

    • Identify potentially pathogenic variants

    • Perform statistical analysis to determine significance of associations

  • Functional characterization of variants:

    • Express wild-type and variant OR4X2 in cellular models

    • Compare receptor trafficking, ligand binding, and signaling

    • Assess impact on neuronal function in relevant models

  • Expression analysis in neural tissues:

    • Examine OR4X2 expression in relevant brain regions

    • Compare expression between healthy and dystonia-affected tissues

    • Investigate potential co-expression with other dystonia-associated genes

What cutting-edge technologies can enhance OR4X2 research?

Recent technological advances offer new opportunities for OR4X2 research:

  • CRISPR-Cas9 genome editing:

    • Generate OR4X2 knockout or knockin models

    • Create reporter systems by tagging endogenous OR4X2

    • Introduce specific mutations to study structure-function relationships

  • Cryo-EM and structural biology:

    • Determine the three-dimensional structure of OR4X2

    • Identify binding pockets and structural features

    • Enable structure-based ligand discovery

  • Single-cell transcriptomics:

    • Profile OR4X2 expression at single-cell resolution

    • Identify cell populations expressing OR4X2 in various tissues

    • Discover co-expression patterns with other genes

  • Organoid models:

    • Study OR4X2 function in more physiologically relevant 3D tissue models

    • Investigate developmental regulation of expression

    • Assess impact of OR4X2 variants in complex cellular environments

What are the potential non-olfactory functions of OR4X2 worth investigating?

Based on emerging roles of olfactory receptors in non-olfactory tissues :

  • Cancer biology:

    • Investigate OR4X2 as a potential biomarker in carcinomas

    • Explore its role in cell proliferation, migration, or apoptosis

    • Study its expression in various cancer types beyond breast cancer

  • Neurodevelopment and function:

    • Examine OR4X2 expression during neural development

    • Investigate potential roles in neuronal migration or axon guidance

    • Study connections to neurological disorders beyond dystonia

  • Signal transduction pathways:

    • Characterize downstream signaling cascades activated by OR4X2

    • Identify interaction partners and signaling modulators

    • Compare signaling in different cell types and contexts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.