Recombinant Human Olfactory receptor 51B4 (OR51B4)

Shipped with Ice Packs
In Stock

Description

Recombinant Protein Production

Recombinant OR51B4 is synthesized via heterologous expression systems, enabling controlled production for research and therapeutic applications.

Production Methods

Expression SystemHost OrganismTagPuritySupplier Examples
Mammalian CellsHEK293His, Fc, Avi>85% (SDS-PAGE)Creative BioMart , Abbexa
YeastYeastHis>85%Cusabio
E. coliBacterialHisFull-lengthCusabio
Wheat GermIn vitroGST, Strep>70-80%AliCE (Antibodies-Online) , Novus

Key Considerations:

  • Conformational Integrity: Wheat germ and mammalian systems preserve native folding for functional studies .

  • Storage: Lyophilized proteins are stable for 12 months at -20°C/-80°C .

Functional and Pathway Roles

OR51B4 exhibits diverse roles in cellular signaling and disease, particularly in oncology.

Cancer-Related Functions

Cancer TypeLigandMechanismEffectReference
ColorectalTroenanPLC activation → Ca²⁺ influx → p38 phosphorylation, reduced Akt/mTOR activityInhibits proliferation, induces apoptosis
Myeloid LeukemiaIsononylCa²⁺ transients → G₂/M cell cycle arrest → erythroid differentiationSuppresses leukemia cell growth

Signaling Pathways:

  • Phospholipase C (PLC): Mediates calcium release-activated (CRAC) channels .

  • Kinase Modulation:

    • p38 MAPK: Phosphorylation promotes apoptosis.

    • Akt/mTOR: Dephosphorylation reduces survival signals .

Comparison with Paralogs

ReceptorLigandFunctionPathwayReference
OR51E1Nonanoic acidInhibits prostate cancer growthSrc kinase, AR signaling
OR51E2β-IononeBlocks prostate cancer proliferationTRPV6 Ca²⁺ channels

Applications in Research

Recombinant OR51B4 is utilized in:

Assay and Detection Tools

ApplicationMethodDetails
ELISAColorimetricMeasures OR51B4 levels in tissues/cell lysates (0.156–10 ng/mL range)
Western BlotGST/His tagsValidates expression in transfected cells (e.g., HCT116 colon cancer)
Protein ArraysFunctional studiesScreens ligand interactions and signaling cascades

Therapeutic Potential

  • Targeted Therapy: Troenan (OR51B4 agonist) shows promise in colorectal cancer treatment .

  • Biomarker: Overexpression in colon cancer tissues suggests diagnostic utility .

Key Discoveries

  1. Antitumor Activity: OR51B4 activation via Troenan reduces colorectal cancer cell migration by 40–60% in scratch assays .

  2. Immune Modulation: OR ligands (e.g., butter aroma compounds) alter neutrophil chemotaxis .

  3. Structural Insights: No crystal structures available; homology models predict ligand-binding motifs in TM domains .

Limitations

  • Ligand Specificity: Few physiological ligands identified (Troenan is a synthetic agonist) .

  • Heterogeneity: Post-translational modifications (e.g., glycosylation) may vary by expression system .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR51B4; Olfactory receptor 51B4; Odorant receptor HOR5'beta1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR51B4
Target Protein Sequence
MWYNNSAGPFLLTGFLGSEAVHYRISMSFFVIYFSVLFGNGTLLVLIWNDHSLHEPMYYF LAMLADTDLGMTFTTMPTVLGVLLLDQREIAHAACFTQSFIHSLAIVESGILLVLAYDCF IAIRTPLRYNCILTNSRVMNIGLGVLMRGFMSILPIILSLYCYPYCGSRALLHTFCLHQD VIKLACADITFNHIYPIIQTSLTVFLDALIIIFSYILILKTVMGIASGQEEAKSLNTCVS HISCVLVFHITVMGLSFIHRFGKHAPHVVPITMSYVHFLFPPFVNPIIYSIKTKQIQRSI IRLFSGQSRA
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 14708

KEGG: hsa:79339

STRING: 9606.ENSP00000369573

UniGene: Hs.679499

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural classification and membrane topology of OR51B4?

OR51B4 belongs to the olfactory receptor family, which is the largest subfamily of G-protein-coupled receptors (GPCRs). Like other olfactory receptors, OR51B4 exhibits the characteristic 7-transmembrane domain structure shared with many neurotransmitter and hormone receptors .

The protein features:

  • Seven hydrophobic transmembrane α-helical domains that span the cell membrane

  • An extracellular N-terminus

  • An intracellular C-terminus that interacts with G proteins

  • Three extracellular loops and three intracellular loops

  • A binding pocket for odorant molecules formed by the transmembrane domains

OR51B4 is part of Class II (tetrapod-specific) olfactory receptors, distinguishing it from Class I (fish-like) receptors. This classification is based on phylogenetic analysis and sequence homology . The receptor's structure enables it to recognize specific odorant molecules and trigger signal transduction cascades involved in smell perception.

How should recombinant OR51B4 be handled and stored in laboratory settings?

For optimal stability and activity of recombinant OR51B4 protein:

Storage conditions:

  • Store at -20°C for regular use

  • For extended storage, conserve at -20°C or -80°C

  • Avoid repeated freezing and thawing cycles as this significantly reduces protein activity

  • Working aliquots can be stored at 4°C for up to one week

Shelf life considerations:

  • Liquid form: approximately 6 months at -20°C/-80°C

  • Lyophilized form: approximately 12 months at -20°C/-80°C

  • Shelf life depends on multiple factors including buffer ingredients, storage temperature, and the intrinsic stability of the protein itself

When working with recombinant OR51B4, it's advisable to:

  • Divide the stock into small working aliquots to minimize freeze-thaw cycles

  • Use appropriate detergents or lipid environments for functional studies, as this is a transmembrane protein

  • Follow recommended buffer conditions for your specific application

In which tissues is OR51B4 expressed beyond the olfactory epithelium?

Research has demonstrated that OR51B4 expression extends beyond the nasal epithelium, exhibiting ectopic expression in multiple tissues. This reflects the emerging understanding that olfactory receptors have diverse physiological functions throughout the body.

Tissue expression profile of OR51B4:

Tissue TypeDetection MethodReported FunctionReference
Colorectal tissueRT-PCR, calcium imagingAffects cell proliferation and migration
Gastrointestinal tractRT-PCR, IH (immunohistochemistry)Potential role in gut physiology
Blood/Immune cellsRT-PCRNot fully characterized
Other tissuesSingle-cell transcriptomicsVariable expression, tissue-dependent

The ectopic expression of OR51B4 suggests that this receptor may have physiological roles beyond olfaction. Single-cell transcriptomic analyses have revealed complex patterns of combinatorial OR expression across different tissues, with notable variation in expression intensity . This widespread distribution indicates potentially diverse functions in non-olfactory contexts.

What signaling mechanisms does OR51B4 utilize in different cellular contexts?

OR51B4 employs several signaling pathways depending on the cellular context:

In olfactory neurons:

  • Canonical pathway: Upon odorant binding, OR51B4 activates Gαolf protein

  • This stimulates adenylyl cyclase type III, increasing intracellular cAMP

  • Elevated cAMP opens cyclic nucleotide-gated (CNG) channels

  • The resulting Ca²⁺ influx activates Ca²⁺-activated Cl⁻ channels

  • Cl⁻ efflux generates the depolarizing receptor potential

In colorectal cancer cells:

The diversity in OR51B4 signaling demonstrates how the same receptor can couple to different G proteins and downstream effectors in different cellular environments, resulting in context-specific physiological outcomes.

What methods are commonly used to study OR51B4 expression and function?

Researchers employ various techniques to investigate OR51B4 expression and function:

Expression analysis methods:

  • RT-PCR and qRT-PCR for mRNA detection

  • Western blotting (WB) for protein expression

  • Immunohistochemistry (IH) and immunofluorescence (IF) for tissue localization

  • In situ hybridization (ISH) for mRNA localization

  • Single-cell transcriptomics for expression in individual cells

Functional characterization methods:

  • Calcium imaging (using fluorescent indicators like Fura-2-AM) to measure intracellular Ca²⁺ transients

  • cAMP assays to monitor G protein-coupled signaling

  • Patch-clamp electrophysiology to measure receptor-mediated currents

  • Cell proliferation assays (e.g., MTT assay, BrdU incorporation)

  • Migration assays (e.g., wound healing/scratch assays)

  • Apoptosis assays (e.g., TUNEL, Annexin V staining)

Heterologous expression systems:

  • HEK293 or HEK293T-derived Hana3A cells that stably express accessory proteins

  • These include receptor-transporting proteins and receptor expression enhancing proteins to promote OR surface expression

  • Alternative cell lines include HeLa/Olf, where cAMP increases result in Ca²⁺ influx measurable via fluorescence

When designing experiments to study OR51B4, researchers should consider using multiple complementary techniques to comprehensively characterize its expression and function in the specific cellular context of interest.

How does OR51B4 activation affect colorectal cancer cell physiology?

OR51B4 activation has significant effects on colorectal cancer cell physiology, with potential therapeutic implications:

Cellular responses to OR51B4 activation:

  • Inhibition of cell proliferation

  • Reduction of cell migration capability

  • Induction of apoptotic processes

Molecular signaling cascade:
The agonist Troenan activates OR51B4 in colorectal cancer cells, initiating a complex signaling cascade that includes:

  • Activation of phospholipase C (PLC)-dependent pathway

  • Ca²⁺ influx through calcium release-activated (CRAC) channels

  • Increased phosphorylation of p38 mitogen-activated protein kinase (MAPK)

  • Decreased phosphorylation of mTor and Akt kinases

This signaling pathway diverges from the canonical olfactory signaling pathway, demonstrating the context-specific nature of OR51B4 signaling. The net effect on cancer cells is anti-proliferative and pro-apoptotic, suggesting potential therapeutic applications.

Research implications:
These findings position OR51B4 as a potential therapeutic target for colorectal carcinoma. Future research should focus on:

  • Developing more selective and potent OR51B4 agonists

  • Investigating potential synergies with established chemotherapeutic agents

  • Exploring the effects of OR51B4 activation in vivo using animal models

  • Determining whether differential expression of OR51B4 correlates with clinical outcomes in colorectal cancer patients

What is the relationship between OR51B4, genetic polymorphisms, and olfactory cognition?

Investigations into the genetic basis of olfactory cognition have revealed fascinating connections with OR51B4:

Genetic variation in OR51B4:

  • Extremely high levels of single nucleotide polymorphisms (SNPs) have been identified in the promoter regions of OR genes, including OR51B4

  • These polymorphisms may create diversity in regulatory mechanisms controlling OR51B4 expression levels

  • This genetic diversity could contribute to individual variations in olfactory perception

Functional consequences:
The high level of polymorphisms in OR51B4 and other olfactory receptor promoters may be responsible for:

  • Diverse regulatory mechanisms controlling expression levels of olfactory receptor proteins

  • Great variability in olfactory cognition of environmental stimuli

  • Wide range of emotional and behavioral reactions to olfactory stimuli

Research applications:
Understanding these genetic variations can inform:

  • Personalized approaches to olfactory-based diagnostics

  • Development of targeted olfactory-based therapies

  • Improved understanding of individual differences in response to odorants

  • Potential markers for olfactory dysfunction or hypersensitivity

These findings highlight how genetic variations in OR51B4 may contribute to the remarkable diversity in human olfactory perception and response.

How can OR51B4 be utilized as a biosensor for chemical detection?

OR51B4 shows promising potential as a biological sensing scaffold for chemical detection, leveraging its natural role as an odorant detector:

Current approaches to OR51B4-based biosensors:

  • Cell-based systems: Heterologous expression in cells engineered with reporter genes

  • Protein-based systems: Purified receptor incorporated into artificial membrane systems

  • These systems can translate receptor activation into measurable signals (fluorescence, electrical, etc.)

Advantages of OR51B4 as a biosensor:

  • Ability to detect compounds not amenable to detection using other biological scaffolds

  • Potential for high sensitivity to specific chemical classes

  • Capability to distinguish between structurally similar compounds

  • Biological relevance of detection (i.e., compounds that can trigger physiological responses)

Technical challenges:
Several obstacles must be overcome for effective OR51B4-based biosensors:

  • Limited knowledge of specific ligands that activate OR51B4

  • Challenges in functional expression outside of native cellular environment

  • Need for orthogonal signaling cascades for multiplex activation

  • Requirement for improved receptor stability in sensing platforms

Future directions:
Research is advancing toward:

  • Deorphanization of OR51B4 using in silico, experimental, and machine learning approaches

  • Development of cell-free systems for more practical deployment

  • Integration with microfluidic and electronic platforms for signal amplification

  • Combination with other sensing modalities for broader detection capabilities

As these challenges are addressed, OR51B4-based biosensors could find applications in environmental monitoring, food safety, medical diagnostics, and security screening.

What are the current challenges and future directions in OR51B4 research?

The field of OR51B4 research faces several challenges but also offers exciting opportunities for future investigation:

Current research limitations:

  • Deorphanization challenges: Limited knowledge of the full spectrum of ligands that activate OR51B4

  • Expression difficulties: Achieving functional expression of OR51B4 in heterologous systems remains technically challenging

  • Signaling complexity: Incomplete understanding of the diverse signaling pathways activated in different cellular contexts

  • Functional redundancy: The combinatorial nature of olfactory coding makes it difficult to isolate specific functions of OR51B4

Emerging research directions:

  • Single-cell analysis: Further application of single-cell transcriptomics to understand OR51B4 expression patterns in health and disease

  • Cancer implications: Exploring the relationship between OR51B4 expression, tumor cell differentiation, and cancer prognosis

  • Therapeutic targeting: Development of specific OR51B4 modulators for potential therapeutic applications, particularly in colorectal cancer

  • Biosensing applications: Advancing the use of OR51B4 as a chemical sensing scaffold for environmental and biomedical applications

Methodological innovations needed:

  • Improved techniques for functional expression of OR51B4 in various systems

  • Development of more selective agonists and antagonists

  • Advanced imaging methods to visualize OR51B4 trafficking and signaling in real-time

  • In silico modeling approaches to predict ligand-receptor interactions

The continued investigation of OR51B4 promises to enhance our understanding of its roles beyond olfaction, potentially leading to novel diagnostic and therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.