Recombinant Human Olfactory receptor 51F2 (OR51F2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary based on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. For shipments with dry ice, please contact us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, briefly centrifuge the vial to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag based on your request.
Synonyms
OR51F2; Olfactory receptor 51F2; Olfactory receptor OR11-23
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR51F2
Target Protein Sequence
MTETSLSSQCFPMSVLNNTIAEPLIFLLMGIPGLKATQYWISIPFCLLYVVAVSGNSMIL FVVLCERSLHKPMYYFLSMLSATDLSLSLCTLSTTLGVFWFEAREINLNACIAQMFFLHG FTFMESGVLLAMAFDRFVAICYPLRYTTILTNARIAKIGMSMLIRNVAVMLPVMLFVKRL SFCSSMVLSHSYCYHVDLIQLSCTDNRINSILGLFALLSTTGFDCPCILLSYILIIRSVL SIASSEERRKAFNTCTSHISAVSIFYLPLISLSLVHRYGHSAPPFVHIIMANVFLLIPPV LNPIIYSVKIKQIQKAIIKVLIQKHSKSNHQLFLIRDKAIYE
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15197

KEGG: hsa:119694

STRING: 9606.ENSP00000323952

UniGene: Hs.553562

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of OR51F2?

OR51F2 is a G-protein-coupled receptor with a characteristic 7-transmembrane domain structure shared by other neurotransmitter and hormone receptors. The protein has a molecular weight of approximately 37 kDa and arises from a single coding-exon gene, which is typical for olfactory receptors . Like other olfactory receptors, it features an extracellular N-terminus that participates in ligand binding and an intracellular C-terminus involved in signaling cascade initiation. The transmembrane domains form a pocket that determines ligand specificity, while intracellular loops mediate G-protein interactions.

How does OR51F2 signaling compare to other olfactory receptors in subfamily 51?

While specific OR51F2 signaling data is limited, we can draw parallels from well-characterized subfamily members like OR51E2. These receptors typically couple to Gα proteins, leading to the elevation of intracellular Ca²⁺ and cAMP upon activation . For instance, OR51E2 activation by β-ionone triggers calcium signaling and activates protein kinases PKA and MAPK3/MAPK1 . The signaling pathways initiated by OR51F2 likely follow similar mechanisms, although ligand specificity would differ based on structural variations in the binding pocket. Researchers should perform comparative signaling experiments to determine OR51F2-specific pathways.

What methodologies are available for identifying OR51F2 ligands?

Several approaches can be employed for deorphanizing OR51F2:

MethodAdvantagesLimitationsData Output
Calcium imagingReal-time detection, single-cell resolutionRequires calcium fluxFluorescence ratio changes
cAMP assaysQuantitative, high sensitivityIndirect measure of activationConcentration curves
Yeast-based screeningHigh-throughput capability, simpler systemMay miss mammalian-specific interactionsGrowth/fluorescence readouts
Machine learning predictionIn silico screening of large librariesRequires validationProbability scores for potential ligands

The yeast-based system has proven particularly effective for rapid deorphanization of human olfactory receptors, allowing functional expression and testing of multiple receptors against diverse ligand panels .

What expression systems are optimal for recombinant OR51F2 production?

Based on successful expression of other olfactory receptors, heterologous systems for OR51F2 production include:

Expression SystemAdvantagesConsiderationsYield Expectations
S. cerevisiaeWell-established for ORs, proper foldingRequires optimization of codon usageModerate
HEK293 cellsMammalian post-translational modificationsNeeds trafficking enhancementVariable
Insect cellsHigher protein yields, eukaryotic processingMore complex cultivationGood

For yeast expression, researchers should consider approaches similar to those used for other olfactory receptors, where ORs are cloned into expression vectors (e.g., at BamHI/SacII sites via Gibson assembly) and co-transformed with sensor constructs . Mammalian expression systems often require co-expression of accessory proteins to enhance surface expression.

How can the functional expression of OR51F2 be verified?

Verification of functional OR51F2 expression requires multiple complementary approaches:

  • Protein expression verification via Western blotting using specific antibodies against OR51F2

  • Subcellular localization assessment through immunocytochemistry to confirm membrane targeting

  • Functional validation through calcium imaging or cAMP assays upon stimulation with potential ligands

  • Flow cytometry to quantify surface expression levels

  • Binding assays with labeled ligands (if available)

The use of epitope tags (FLAG, HA, etc.) can facilitate detection if specific OR51F2 antibodies are not available or lack sensitivity.

What calcium imaging protocols are most effective for studying OR51F2 activation?

Based on protocols used for related olfactory receptors, an effective calcium imaging approach would include:

  • Loading cells expressing OR51F2 with ratiometric calcium indicators (e.g., Fura-2 AM)

  • Establishing baseline measurements before compound application

  • Using specialized pressure-driven microcapillary perfusion systems for instantaneous solution change and focal application of test compounds

  • Measuring fluorescence at appropriate wavelengths (e.g., excited at 340 and 380 nm, measured at 510 nm) and calculating f340/f380 intensity ratio

  • Employing calcium channel blockers and chelators (e.g., EGTA, 2-APB, SKF 96365) to characterize the source of calcium signals

The calcium imaging setup should include an inverted microscope equipped for ratiometric live cell imaging with a xenon arc lamp, motorized filter wheel, and CCD camera for detecting spatiotemporal Ca²⁺-dependent fluorescence signals .

How can RNA interference be used to study OR51F2 function in native tissues?

RNA interference provides a powerful approach to investigate OR51F2 function:

  • Design multiple siRNAs targeting different regions of OR51F2 mRNA

  • Validate knockdown efficiency using RT-PCR and Western blotting

  • Assess functional consequences through calcium imaging or other functional assays

  • Include non-targeting siRNA controls and rescue experiments with siRNA-resistant OR51F2 constructs

  • For long-term studies, consider shRNA or CRISPR-Cas9 approaches

When targeting tissues with potential OR51F2 expression, researchers should first confirm expression through RT-PCR and immunohistochemistry, as olfactory receptors show ectopic expression in multiple non-sensory tissues .

What evidence suggests non-olfactory functions of OR51F2?

While direct evidence for OR51F2 is limited, research on related olfactory receptors provides valuable insights:

  • OR51E2 has been detected in human epidermal melanocytes, where it regulates proliferation, melanogenesis, and dendritogenesis upon activation with β-ionone

  • Olfactory receptors have been found in various non-sensory tissues, including prostate, skin, and blood cells

  • OR activation in non-olfactory tissues can elicit Ca²⁺ signals and regulate cellular functions similar to traditional GPCRs

  • The related receptor OR51E2 is associated with prostate cancer, suggesting potential roles in disease processes

Researchers investigating OR51F2 should examine its expression pattern across tissues and analyze potential physiological functions based on activation-induced cellular responses.

How can OR51F2 be studied in the context of cellular differentiation?

To investigate OR51F2's potential role in cellular differentiation:

  • Examine OR51F2 expression changes during differentiation of relevant cell types

  • Employ gain- and loss-of-function approaches (overexpression and siRNA knockdown)

  • Identify potential endogenous ligands in the tissue microenvironment

  • Analyze downstream signaling pathways, particularly those related to differentiation:

    • MAPK pathway activation

    • Transcription factor phosphorylation

    • Cell cycle regulator expression

  • Perform phenotypic assays relevant to the cell type (e.g., for melanocytes: melanin content, dendrite formation)

Such studies could reveal whether OR51F2, like OR51E2, influences cell differentiation through calcium and cAMP-dependent mechanisms.

What mutagenesis approaches are most informative for OR51F2 structure-function studies?

Strategic mutagenesis can provide valuable insights into OR51F2 function:

Mutation TypeTarget RegionsExpected OutcomesAnalysis Methods
Alanine scanningTransmembrane domainsIdentify critical residues for ligand bindingCalcium imaging, binding assays
Chimeric receptorsN-terminus, loops, C-terminusDetermine domains controlling ligand specificityComparing responses to parental receptor ligands
Phosphorylation site mutationsSerine/threonine residuesAssess regulation by kinasesPhospho-specific antibodies, desensitization assays
Conservative vs. non-conservativeLigand binding pocketStructure-activity relationshipsMolecular modeling, functional assays

For interpreting mutagenesis data, researchers should combine functional assays with computational modeling to correlate structural changes with altered receptor properties.

How can machine learning approaches accelerate OR51F2 ligand discovery?

Machine learning offers powerful tools for OR51F2 ligand prediction:

  • Train algorithms using chemical descriptors of known ligands for related ORs

  • Apply support vector machine or neural network models to predict activity of virtual libraries

  • Validate top predictions through functional assays

  • Refine models based on experimental results

  • Use structural modeling to understand ligand-receptor interactions

This approach has successfully identified novel agonists for other olfactory receptors with hit rates of 39-50% . The transferability of protocols developed for OR51E1 suggests that similar approaches could be effective for OR51F2, allowing researchers to systematically explore chemical spaces associated with this receptor.

How can poor membrane trafficking of recombinant OR51F2 be addressed?

Poor membrane trafficking is a common challenge with olfactory receptors that can be addressed through:

  • Co-expression with accessory proteins like RTP1S, RTP2, REEP1, or Ric-8B

  • Addition of N-terminal trafficking signals from well-expressed GPCRs

  • Temperature manipulation during expression (30°C often improves folding)

  • Use of chemical chaperones in the culture medium

  • Creation of fusion constructs with well-trafficked membrane proteins

  • Codon optimization for the expression system

Researchers should verify surface expression using confocal microscopy with plasma membrane markers or surface biotinylation assays.

What controls are essential when characterizing OR51F2 ligands?

Essential controls for OR51F2 ligand characterization include:

  • Vehicle controls (e.g., DMSO at matching concentrations)

  • Positive controls (known GPCR activators, such as ATP or endothelin-1)

  • Mock-transfected cells to rule out endogenous receptor responses

  • Calcium ionophore (e.g., ionomycin) to confirm cell viability and dye loading

  • Dose-response curves to establish potency and efficacy

  • Testing in the presence of antagonists or after receptor knockdown

  • Cross-activation testing with related receptors to establish specificity

These controls ensure that observed responses are specific to OR51F2 activation rather than artifacts or responses through other receptors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.