Recombinant Human Olfactory receptor 51G1 (OR51G1)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Overview

OR51G1 is a Class I olfactory receptor (fish-like receptors) belonging to family 51 within the GPCR classification . Key features include:

PropertyDetails
Gene LocationChromosome 11p15.4
Protein Structure7-transmembrane domains; N-terminal FLAG and C-terminal rho1D4 tags
Molecular Weight~36 kDa
Ligand SpecificityUndetermined (orphan receptor status)
Signaling PathwayCanonical Gα<sub>olf</sub>/cAMP cascade; potential non-canonical pathways

Recombinant Expression Systems

OR51G1 is heterologously expressed in engineered cell lines to study its structure and function:

  • Host Systems:

    • HEK293 Cells: Stable tetracycline-inducible systems enable high-yield production .

    • Hana3A Cells: Co-expressed with chaperones (RTP1/2) to improve membrane trafficking .

  • Purification Methods:

    • Immunoaffinity chromatography (anti-FLAG/rho1D4 tags) .

    • Size-exclusion chromatography for isolating monomeric/dimeric forms .

  • Yield: ~1.6 mg (monomer) and ~1.1 mg (dimer) per 60 T175 flasks .

Research Applications and Findings

OR51G1 has been utilized in diverse experimental contexts:

Antibody Development

  • Polyclonal Antibodies: Rabbit-derived anti-OR51G1 antibodies (e.g., MyBioSource MBS6328958) show specificity for Western blot (1:500–1:2000 dilution) and immunofluorescence (1:200–1:1000) .

  • Epitope Mapping: Antibodies target the C-terminal region (residues 199–248) .

Ligand Screening

  • High-Throughput Assays: Calcium imaging and cAMP luciferase reporter systems identify potential agonists/antagonists .

  • Challenges: Low cell-surface expression in vitro complicates ligand deorphanization .

Pathophysiological Correlations

While direct evidence for OR51G1 is limited, paralogs like OR51E1 provide mechanistic clues:

  • Cardiovascular Regulation: OR51E1 activation alters cardiac contractility via fatty acid sensing .

  • Cancer Biomarker Potential: OR51E1/OR51E2 overexpression correlates with prostate cancer progression .

Challenges in OR51G1 Research

  • Low Solubility: Requires detergent stabilization (e.g., n-dodecyl-β-D-maltoside) .

  • Functional Redundancy: Overlaps with other Class I receptors complicate phenotype interpretation .

  • Sex-Specific Signaling: Demonstrated in OR51E1 variants , suggesting OR51G1 may exhibit similar dimorphism.

Future Directions

  • Crystallography/NMR: Resolve 3D structures to guide drug design .

  • In Vivo Models: Knockout mice to elucidate physiological roles beyond olfaction.

  • Therapeutic Targeting: Exploit OR51G1 in metabolic or cancer pathways akin to OR51E1 .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR51G1; OR51G3P; Olfactory receptor 51G1; Olfactory receptor 51G3; Olfactory receptor OR11-29
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-321
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR51G1
Target Protein Sequence
MTILLNSSLQRATFFLTGFQGLEGLHGWISIPFCFIYLTVILGNLTILHVICTDATLHGP MYYFLGMLAVTDLGLCLSTLPTVLGIFWFDTREIGIPACFTQLFFIHTLSSMESSVLLSM SIDRYVAVCNPLHDSTVLTPACIVKMGLSSVLRSALLILPLPFLLKRFQYCHSHVLAHAY CLHLEIMKLACSSIIVNHIYGLFVVACTVGVDSLLIFLSYALILRTVLSIASHQERLRAL NTCVSHICAVLLFYIPMIGLSLVHRFGEHLPRVVHLFMSYVYLLVPPLMNPIIYSIKTKQ IRQRIIKKFQFIKSLRCFWKD
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 14738

KEGG: hsa:79324

STRING: 9606.ENSP00000322546

UniGene: Hs.554541

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR51G1 and what is its biological function?

OR51G1 (olfactory receptor family 51 subfamily G member 1) is a G-protein-coupled receptor (GPCR) belonging to the olfactory receptor gene family, which is the largest gene family in the human genome. Olfactory receptors interact with odorant molecules in the nose to initiate neuronal responses that trigger the perception of smell. OR51G1 specifically belongs to the OR51 subfamily, which is categorized as Class I ORs that predominantly recognize carboxylic acid odorants .

Functionally, OR51G1 plays a crucial role in the sense of smell by detecting specific odorants and initiating olfactory signaling pathways. Like other olfactory receptors, it participates in G protein-mediated transduction of odorant signals . Interestingly, OR51G1 is considered a segregating pseudogene, meaning some individuals possess alleles that encode functional olfactory receptors, while others have alleles encoding proteins predicted to be non-functional .

What structural characteristics define OR51G1 as a G-protein-coupled receptor?

OR51G1, like other olfactory receptors, shares a characteristic 7-transmembrane domain structure common to G-protein-coupled receptors (GPCRs) . While specific structural data for OR51G1 itself is limited, related receptors in the OR51 subfamily provide valuable insights.

For instance, the structure of consOR51 (a consensus sequence derived from the OR51 subfamily) shows remarkable similarity to the native human receptor OR51E2. Both feature a conserved arginine residue (R264 in consOR51 and R262 in OR51E2) that is critical for engaging the carboxylic acid of odorants like propionate . This conserved arginine (designated as position 6x59 in the modified Ballesteros-Weinstein numbering system for GPCRs) is likely present in OR51G1 as well, given its classification in the same subfamily.

The binding pocket of Class I ORs like those in the OR51 subfamily is specifically designed to interact with carboxylic acid moieties of odorants, with hydrophobic interactions between the aliphatic tail of fatty acids and the odorant binding pocket conferring fatty acid-mediated activity and selectivity .

How can OR51G1 expression be detected in research settings?

Multiple experimental approaches can be employed to detect OR51G1 expression:

  • Antibody-based detection: Polyclonal and monoclonal antibodies specific to OR51G1 are available for research purposes. The OR51G1 Polyclonal Antibody has been validated for Western blotting (recommended dilution 1:500-1:2000), immunofluorescence (recommended dilution 1:200-1:1000), and ELISA (recommended dilution 1:5000) . Similarly, the OR51G1 Monoclonal Antibody has been validated for immunohistochemistry and immunofluorescence applications, enabling precise localization and visualization of OR51G1 expression in tissues and cells .

  • Gene expression analysis: While not explicitly mentioned in the search results, standard techniques such as RT-PCR, qPCR, or RNA-Seq can be employed to detect OR51G1 mRNA expression in various tissues.

  • Functional assays: Cellular response assays using reporter systems (such as luciferase assays) in cell lines like Hana3A, which express chaperon proteins like RTP1 or RTP2, olfactory G-protein, and rho tag, can be used to detect functional expression of OR51G1 .

What challenges are associated with heterologous expression of OR51G1?

Heterologous expression of olfactory receptors, including OR51G1, presents significant challenges for researchers. The vast majority of individual OR51 subfamily members fail to express at measurable levels in commonly used cell lines like HEK293T, with the exception of OR51E2 and, to a lesser extent, OR51E1 .

This expression challenge is a common hurdle in OR research and has prompted the development of alternative approaches:

  • Consensus sequence approach: Researchers have designed consensus constructs (like consOR51) that retain the most common amino acid at each aligned position from multiple members of a receptor subfamily. Such consensus constructs have demonstrated improved expression levels compared to their native counterparts .

  • Use of specialized cell lines: Cell lines like Hana3A, which express chaperon proteins such as RTP1 or RTP2, olfactory G-protein, and rho tag, can enhance the functional expression of olfactory receptors .

  • Codon optimization: While not explicitly mentioned in the search results, codon optimization is a standard approach to improve heterologous protein expression.

These strategies may be applicable to improving the expression of recombinant OR51G1 in research settings.

How does OR51G1 compare to other members of the OR51 subfamily in terms of sequence homology and function?

The OR51 subfamily comprises multiple members that share varying degrees of sequence homology. Analysis of the OR51 subfamily revealed that individual members range from 45% to 74% amino acid identity when compared with consOR51 (a consensus construct of the subfamily) .

Phylogenetic analysis of the OR51 subfamily places consOR51 at the root of the extant sequences, suggesting it represents ancestral characteristics of this receptor group. Within this subfamily, OR51E2 and OR51E1 are notable for their measurable expression levels in heterologous systems, unlike most other subfamily members that fail to express at detectable levels in common cell lines like HEK293T .

Functionally, members of the OR51 subfamily belong to Class I ORs, which primarily recognize carboxylic acid odorants. The binding pocket of these receptors contains a conserved arginine residue (position 6x59) that engages the carboxylic acid moiety of odorants. Additionally, hydrophobic interactions between the aliphatic tail of fatty acids and the odorant binding pocket confer fatty acid-mediated activity and selectivity .

Notably, some OR51 subfamily members like OR51E1 have been documented in non-olfactory tissues. For instance, OR51E1 has been found along the gastrointestinal tract, where it co-localizes with enteroendocrine cells and may be modulated by intestinal microbiota .

What experimental methods are used to study OR51G1 activation by odorants?

Several experimental approaches are employed to study olfactory receptor activation by odorants:

  • Luciferase reporter assays: These constitute approximately 41% of bioassay results in the OR field. The Hana3A cell line, which expresses chaperon proteins like RTP1 or RTP2, olfactory G-protein, and rho tag, is commonly used for these assays .

  • Dose-response measurements: Researchers evaluate receptor activation across a range of odorant concentrations to determine parameters such as EC50 values. This approach recognizes that olfactory perception is dependent on odorant concentration, and changes in concentration can lead to different perceptions of hedonicity or olfactory quality .

  • Mutagenesis studies: Site-directed mutagenesis of key residues in the binding pocket allows researchers to assess their contribution to odorant recognition and receptor activation. For example, alanine mutations of binding pocket residues have been used to evaluate how different odorants engage with receptors .

  • Integrated analysis: To capture the combined effects of efficacy and potency, researchers calculate the integrated area under the dose-response curve for wild-type and mutant receptors exposed to various odorants .

  • Structural biology approaches: Cryo-EM structures of related ORs (such as consOR51) provide insights into odorant binding mechanisms, which can be extended to OR51G1 through homology modeling .

How can researchers utilize molecular modeling to predict OR51G1-odorant interactions?

Molecular modeling approaches have proven valuable for predicting and understanding OR-odorant interactions:

What is known about the potential non-olfactory functions of OR51G1?

While the search results don't specifically address non-olfactory functions of OR51G1, research on related ORs provides valuable context:

Members of the OR51 subfamily have been documented in non-olfactory tissues. For instance, OR51E1 has been found along the gastrointestinal tract of pigs, where it co-localizes with enteroendocrine cells. Its expression appears to be modulated by intestinal microbiota, suggesting a potential role in sensing microbial metabolites in the gut .

Similar studies have shown the expression of another olfactory receptor, Olfr78, in enteroendocrine cells of the colon . These findings suggest that olfactory receptors, including potentially OR51G1, may serve as chemosensors in non-olfactory tissues, detecting various metabolites and participating in physiological processes beyond olfaction.

The butyrate-sensing capability of OR51E1 in the gastrointestinal tract suggests that OR51G1, as a member of the same subfamily, might also have sensory functions in non-olfactory tissues, particularly in detecting carboxylic acid-containing compounds .

What antibodies and detection methods are available for OR51G1 research?

Several antibodies and detection methods are available for OR51G1 research:

  • OR51G1 Polyclonal Antibody: This antibody detects endogenous levels of OR51G1 protein and has been validated for various applications with recommended dilutions:

    • Western Blotting: 1:500-1:2000

    • Immunofluorescence: 1:200-1:1000

    • ELISA: 1:5000

  • OR51G1 Monoclonal Antibody (PACO05358): Produced through a hybridoma cell line, this antibody exhibits high specificity and sensitivity in detecting OR51G1. It has been validated for:

    • Immunohistochemistry

    • Immunofluorescence

These antibodies enable precise localization and visualization of OR51G1 expression in tissues and cells, making them invaluable tools for researchers investigating the distribution and function of this receptor.

Antibody TypeApplicationsRecommended DilutionsSource
PolyclonalWB, IF, ELISAWB: 1:500-1:2000, IF: 1:200-1:1000, ELISA: 1:5000
Monoclonal (PACO05358)IHC, IFNot specified

When selecting an antibody for OR51G1 research, researchers should consider the specific application, required sensitivity, and whether polyclonal or monoclonal antibodies better suit their experimental design.

How can researchers utilize databases to study OR51G1-odorant interactions?

Databases like M2OR provide valuable resources for studying OR-odorant interactions:

M2OR is currently the largest database available in the literature on OR bioassays, containing 75,050 different experiments representing 51,395 unique OR-odorant pairs. It includes information on 768 compounds tested against various ORs, with 6% of the pairs showing agonistic activity .

For OR51G1 research, such databases offer several advantages:

  • Concentration-dependent data: Unlike previous databases, M2OR includes either screening concentration or EC50 values for all gathered experimental data, allowing analysis of OR-molecule interactions beyond simple responsiveness .

  • Stereochemical information: M2OR provides stereochemistry information for molecules, which is crucial as certain ORs have different responses to enantiomers .

  • Comprehensive experimental details: The database includes information about molecules (Name, CID, CAS, InChIKey, SMILES) and receptors (Gene name, UniProt ID, Sequence, Mutation, Species), as well as details about the response .

  • Bioassay methodology: 41% of the bioassay results in the database are from luciferase assays using the Hana3A cell line, which expresses chaperon proteins, olfactory G-protein, and rho tag .

Researchers can leverage these resources to:

  • Identify potential odorants that may interact with OR51G1

  • Compare OR51G1's response profile with related receptors

  • Design experiments with appropriate concentration ranges

  • Consider stereochemical factors in odorant recognition

What approaches are effective for engineering functional recombinant OR51G1?

Based on strategies used for related olfactory receptors, several approaches may enhance the functional expression of recombinant OR51G1:

  • Consensus sequence approach: Creating a consensus construct that retains the most common amino acid at each aligned position from multiple members of the OR51 subfamily has shown promise. For example, consOR51 expressed at levels higher than OR51E2 in HEK293T cells, despite most individual OR51 subfamily members failing to express at measurable levels .

  • Specialized expression systems: Using cell lines like Hana3A, which express chaperon proteins (RTP1, RTP2), olfactory G-protein, and rho tag, can significantly improve the functional expression of olfactory receptors .

  • Targeted mutagenesis: Structure-guided mutagenesis based on homology modeling with related receptors like consOR51 or OR51E2 may help identify and modify residues that affect expression and stability without compromising function .

  • Deorphanization strategies: Systematic screening approaches, as used for colon ORs against chemicals likely to bind ORs in olfactory tissue, can be adopted to identify ligands for OR51G1, which can then facilitate functional expression studies .

  • Machine learning protocols: Machine learning approaches based on chemical features have been developed as efficient tools for screening ligands for G-protein-coupled odorant receptors, which could be applied to OR51G1 .

What are the emerging areas of research regarding OR51G1 and its potential applications?

Several emerging research areas hold promise for advancing our understanding of OR51G1:

  • Non-olfactory functions: Investigating potential roles of OR51G1 in non-olfactory tissues, similar to how OR51E1 has been found in the gastrointestinal tract co-localizing with enteroendocrine cells . This could reveal novel physiological functions of OR51G1 beyond olfaction.

  • Genetic variation studies: As OR51G1 is described as a segregating pseudogene (where some individuals have functional alleles while others have non-functional ones) , research into how this genetic variation affects olfactory perception and potentially other physiological processes represents an important frontier.

  • Therapeutic applications: Understanding OR51G1's function could potentially lead to therapeutic interventions for olfactory-related disorders . Additionally, if OR51G1 has non-olfactory functions, this could open avenues for targeting it in other disease contexts.

  • Computational approaches: Machine learning protocols based on chemical features represent efficient tools for screening ligands for G-protein-coupled odorant receptors, including OR51G1 . Further development of these computational approaches could accelerate the discovery of OR51G1 ligands and modulators.

  • Structural biology: The successful determination of structures for consensus ORs like consOR51 paves the way for similar approaches with OR51G1, which would significantly advance our understanding of its molecular recognition mechanisms.

How might advances in structural biology techniques enhance OR51G1 research?

Recent advances in structural biology have revolutionized GPCR research and offer promising applications for OR51G1 studies:

  • Cryo-EM structure determination: The successful determination of cryo-EM structures for consensus olfactory receptors like consOR51 demonstrates the feasibility of this approach for members of the OR51 subfamily . A structure of OR51G1 or a close proxy would provide unprecedented insights into its odorant binding mechanism.

  • Homology modeling with improved templates: As more structures of related ORs become available, the accuracy of homology models for OR51G1 will improve. The structure of consOR51 has already yielded a homology model of a related member of the human OR51 family with high predictive power .

  • Structure-guided mutagenesis: Structural insights enable rational design of mutations to probe specific aspects of receptor function, as demonstrated by studies on consOR1 and OR1A1 where mutations differentially affected the activity of different odorants .

  • Understanding activation mechanisms: Structures of ORs in different conformational states could illuminate the molecular basis of receptor activation, as distinct modes of odorant-binding and activation mechanisms have been observed between Class I and Class II ORs .

  • Ligand discovery and optimization: Structural data can guide virtual screening and structure-based design of novel ligands or modulators for OR51G1, potentially leading to compounds with improved affinity, selectivity, or pharmacokinetic properties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.