Recombinant Human Olfactory receptor 51Q1 (OR51Q1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

OR51Q1 is encoded by the OR51Q1 gene (Entrez Gene ID: 390061) located on human chromosome 11. The recombinant protein corresponds to amino acids 1–26 of the full-length receptor and is commonly used as a control fragment in antibody validation experiments .

Key molecular features:

PropertyDetail
UniProt IDQ8NH59
Protein Length (Full)312 amino acids
Gene FamilyClass I ORs (fish-like receptors)
Conserved Domains7-transmembrane GPCR structure with Pfam PF13853 and InterPro IPR000725
Sequence Identity69% to mouse/rat orthologs

The recombinant protein is expressed in E. coli and validated for specificity in Western blot (WB), immunohistochemistry (IHC), and immunocytochemistry (ICC) .

Functional Insights

OR51Q1 operates via G-protein-coupled signaling:

  1. Odorant binding induces conformational changes, activating Gα<sub>olf</sub> proteins.

  2. Adenylate cyclase generates cAMP, triggering Ca<sup>2+</sup>/Na<sup>+</sup> influx and neuronal depolarization .

Ligand interactions:

  • Predicted ligands: Carboxylic acids and hydrophilic odorants (shared with OR51E2) .

  • Key residues: R264 (odorant recognition), F110 (modulates basal activity) .

Functional studies of OR51Q1 remain limited, but homology to OR51E2 suggests similar activation mechanisms. For example, OR51E2 responds to propionate via R262, a residue homologous to R264 in consOR51 .

Research Applications

Recombinant OR51Q1 is primarily used as a tool for:

Antibody Validation

  • Acts as a blocking control for antibody PA5-60890 in WB and IHC at 100x molar excess .

Ligand Screening

  • Machine learning models trained on OR51E1/OR51E2 data can predict OR51Q1 ligands, leveraging shared binding motifs .

Challenges and Future Directions

  • Low expression levels: Native OR51Q1 is difficult to express in heterologous systems, necessitating engineered constructs like consOR51 for structural studies .

  • Deorphanization: Ligands for OR51Q1 remain unconfirmed; high-throughput screening paired with computational modeling is needed .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag.
Synonyms
OR51Q1; Olfactory receptor 51Q1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR51Q1
Target Protein Sequence
MSQVTNTTQEGIYFILTDIPGFEASHIWISIPVCCLYTISIMGNTTILTVIRTEPSVHQR MYLFLSMLALTDLGLTLTTLPTVMQLLWFNVRRISSEACFAQFFFLHGFSFMESSVLLAM SVDCYVAICCPLHYASILTNEVIGRTGLAIICCCVLAVLPSLFLLKRLPFCHSHLLSRSY CLHQDMIRLVCADIRLNSWYGFALALLIIIVDPLLIVISYTLILKNILGTATWAERLRAL NNCLSHILAVLVLYIPMVGVSMTHRFAKHASPLVHVIMANIYLLAPPVMNPIIYSVKNKQ IQWGMLNFLSLKNMHSR
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 14851

KEGG: hsa:390061

STRING: 9606.ENSP00000300778

UniGene: Hs.528592

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR51Q1 and where is it expressed in human tissues?

OR51Q1 is a member of the olfactory receptor family, belonging to the large superfamily of G-protein-coupled receptors (GPCRs). While primarily associated with olfactory sensory neurons in the nasal epithelium, olfactory receptors including those in the OR51 family are increasingly recognized for their ectopic expression in non-olfactory tissues.

Similar to other olfactory receptors like OR51E1 which has been detected in enteroendocrine cells of the gastrointestinal tract, OR51Q1 may exhibit tissue-specific expression patterns . A systematic analysis approach similar to that used by Flegel et al. (2013) with deep sequencing would be recommended to determine the complete expression profile of OR51Q1 across human tissues .

To investigate OR51Q1 expression:

  • Perform RNA-Seq analysis of various tissue samples

  • Validate with quantitative RT-PCR using OR51Q1-specific primers

  • Confirm protein expression through immunohistochemistry using validated antibodies

How can I clone and express recombinant OR51Q1?

Cloning and expression of OR51Q1 requires specialized techniques due to the challenging nature of GPCR expression in heterologous systems.

Recommended protocol:

  • Obtain OR51Q1 cDNA from human tissue or synthesize based on reference sequence

  • Design primers with appropriate restriction sites for your expression vector

  • Amplify OR51Q1 coding sequence using high-fidelity polymerase

  • Clone into a mammalian expression vector with:

    • Strong promoter (e.g., CMV)

    • N-terminal tag (e.g., Rho tag or FLAG tag) to improve membrane trafficking

    • Reporter system (e.g., luciferase) for functional assays

Expression systems comparison:

Expression SystemAdvantagesDisadvantagesSuitability for OR51Q1
HEK293 cellsHigh transfection efficiency, mammalian processingVariable surface expressionGood for initial screening
Yeast (S. cerevisiae)Rapid deorphanization potential, cost-effectiveDifferent membrane compositionExcellent for ligand screening
Xenopus oocytesLarge cells for electrophysiologyLabor intensiveGood for detailed functional studies

What are the common challenges in working with recombinant olfactory receptors like OR51Q1?

Several technical challenges must be addressed when working with OR51Q1:

  • Poor surface expression: ORs often exhibit inefficient trafficking to the plasma membrane in heterologous systems. Consider using trafficking enhancers like RTP1S and REEP1 co-expression .

  • Functional validation: Confirming that recombinant OR51Q1 maintains native functionality requires robust assay systems.

  • Ligand identification: The vast chemical space of potential odorants makes deorphanization challenging. A systematic approach using chemical feature-based machine learning can improve screening efficiency, similar to methods used for other ORs .

  • Signal-to-noise ratio: Distinguishing specific OR51Q1 activation from background requires careful experimental design with appropriate controls .

What expression systems are suitable for OR51Q1 functional studies?

The choice of expression system significantly impacts the success of OR51Q1 functional studies:

Heterologous luciferase assay system:
This approach has been successfully used to screen multiple odorants against olfactory receptors . For OR51Q1:

  • Transfect HEK293 cells with OR51Q1 expression construct

  • Co-transfect with Gα15/16 to couple receptor activation to calcium signaling

  • Include a luciferase reporter under control of a cAMP or calcium-responsive element

  • Measure luminescence following odorant exposure

Yeast expression system:
Yeast-based systems offer advantages for rapid deorphanization:

  • Transform OR51Q1 into modified yeast strains with humanized G-protein coupling

  • Include reporter genes (e.g., LacZ or fluorescent proteins) activated by receptor signaling

  • Screen compound libraries in high-throughput format

How can I identify potential ligands for OR51Q1?

Deorphanization of OR51Q1 requires a strategic approach combining computational predictions and experimental validation:

Machine learning-based prediction:

  • Compile known odorant-receptor pairing data from related ORs

  • Extract chemical descriptors from potential ligands

  • Train machine learning models (e.g., support vector machines) to predict OR51Q1 agonists

  • Select top candidates for experimental testing

This approach has successfully identified novel agonists for other ORs with hit rates of 39-50% .

Experimental validation:

  • Primary screening: Test candidates at a single concentration (e.g., 100 μM)

  • Secondary screening: Confirm hits from primary screen

  • Dose-response analysis: Test active compounds at concentrations from 10 nM to 10 mM

  • Data analysis: Fit to sigmoidal curves and determine EC50 values

Analysis ParameterAcceptance Criteria for Valid Ligand
Top vs Bottom of curve95% confidence intervals should not overlap
Log EC50 standard deviation< 1 log unit
Statistical significancep < 0.05 in comparison to vector-only control

What experimental design is optimal for deorphanization of OR51Q1?

An effective experimental design for OR51Q1 deorphanization should follow these systematic steps:

  • Define variables:

    • Independent variable: Concentration of test compounds

    • Dependent variable: Receptor activation (e.g., luciferase signal, calcium flux)

    • Control variables: Temperature, pH, cell density, expression levels

  • Formulate specific hypotheses:

    • Primary hypothesis: "Compound X activates OR51Q1 in a dose-dependent manner"

    • Secondary hypothesis: "OR51Q1 responds preferentially to compounds with specific chemical features"

  • Design treatment conditions:

    • Test compounds at multiple concentrations (10 nM to 10 mM)

    • Include positive controls (known OR agonists)

    • Include negative controls (vector-only transfected cells)

  • Assignment strategy:

    • Between-subjects: Different compounds tested in separate wells

    • Within-subjects: Multiple concentrations of the same compound tested across replicates

  • Measurement approach:

    • Real-time calcium imaging for temporal resolution

    • End-point luciferase assay for high-throughput screening

    • Each condition tested in triplicate with cells from the same parent plate

How can I characterize the signaling pathways activated by OR51Q1?

Understanding OR51Q1 signaling requires comprehensive pathway analysis:

  • G-protein coupling profiling:

    • Perform assays with inhibitors of different G-protein subtypes

    • Measure second messenger production (cAMP, IP3, calcium)

    • Compare signaling efficiency across different G-protein partners

  • Downstream signaling characterization:
    Similar to analyses performed for OR51B5 :

    • Examine calcium channel involvement (L-type, T-type)

    • Assess MAPK pathway activation through western blot analysis

    • Investigate functional outcomes (e.g., cell proliferation, gene expression changes)

  • Biased signaling analysis:

    • Test if different ligands preferentially activate different pathways

    • Measure multiple readouts simultaneously (calcium, cAMP, β-arrestin recruitment)

What approaches are available for studying OR51Q1 structure-function relationships?

Several approaches can elucidate the structure-function relationships of OR51Q1:

  • Site-directed mutagenesis:

    • Identify key residues within the predicted binding pocket

    • Create point mutations and assess their impact on ligand binding and signaling

    • Focus on residues conserved among structurally similar ORs

  • Chimeric receptor approach:

    • Create chimeras between OR51Q1 and related receptors with known ligands

    • Map functional domains responsible for ligand specificity

    • Identify regions critical for G-protein coupling

  • Molecular modeling:

    • Develop homology models based on available GPCR structures

    • Perform molecular docking simulations with potential ligands

    • Validate predictions through functional assays of mutated receptors

  • Resonance energy transfer techniques:

    • Use FRET or BRET to study receptor conformation changes

    • Investigate oligomerization patterns

    • Examine protein-protein interactions with signaling partners

What are the optimal conditions for functional expression of OR51Q1?

Optimizing OR51Q1 expression requires attention to several parameters:

Expression enhancement strategies:

  • Co-expression with trafficking proteins (RTP1S, REEP1)

  • Addition of N-terminal tags that facilitate surface expression

  • Codon optimization for the selected expression system

  • Temperature modulation (30-32°C incubation can improve folding)

Transfection optimization:

ParameterRecommended RangeOptimization Metric
DNA concentration0.5-2 μg per well (6-well plate)Surface expression
Transfection reagent ratio1:2 to 1:4 (DNA:reagent)Transfection efficiency
Incubation time24-48 hours post-transfectionFunctional response
Cell density70-90% confluenceCell viability

How can I validate the functional activity of recombinant OR51Q1?

Functional validation requires multiple complementary approaches:

  • Surface expression confirmation:

    • Flow cytometry using antibodies against epitope tags

    • Immunofluorescence microscopy to visualize membrane localization

    • Biotinylation assays to quantify surface proteins

  • Ligand binding assays:

    • Competition binding with known ligands (if available)

    • Direct binding measurements using labeled ligands

  • Functional response measurements:

    • Calcium imaging using fluorescent indicators

    • cAMP accumulation assays

    • GTPγS binding to measure G-protein activation

    • Reporter gene assays (luciferase, SEAP)

  • Dose-response characterization:

    • Determine EC50 values for identified ligands

    • Compare efficacy (maximal response) across ligands

    • Analyze response kinetics through real-time measurements

What techniques are available for studying OR51Q1-ligand interactions?

Several techniques can provide insights into OR51Q1-ligand interactions:

  • Calcium imaging:

    • Real-time visualization of receptor activation

    • Single-cell resolution to assess population heterogeneity

    • Ability to record temporal response profiles

  • High-throughput screening:

    • Luciferase-based reporter assays

    • FLIPR (Fluorometric Imaging Plate Reader) technology

    • Automated liquid handling systems for compound libraries

  • Electrophysiological approaches:

    • Patch-clamp recording in heterologous systems

    • Measurement of downstream ion channel activity

    • Analysis of receptor desensitization kinetics

  • Structural biology techniques:

    • Cryo-electron microscopy for structural determination

    • NMR spectroscopy for ligand binding analysis

    • Hydrogen-deuterium exchange mass spectrometry

How can I analyze transcriptional variants of OR51Q1?

Analysis of OR51Q1 transcriptional variants requires comprehensive RNA analysis:

  • RNA-Seq approach:

    • Perform stranded RNA-Seq to detect sense and antisense transcripts

    • Analyze both coding and non-coding regions

    • Identify alternative promoters and splice variants

  • Variant characterization:

    • Map exon-intron structures of identified transcripts

    • Determine if variants encode functional proteins

    • Identify tissue-specific expression patterns of variants

  • Antisense transcript analysis:

    • Search for antisense transcripts overlapping with OR51Q1

    • Characterize their exon-intron structure

    • Investigate potential regulatory functions

Many ORs show antisense transcripts that may regulate gene expression. For example, OR8D1 and OR1C1 have antisense transcripts with multiple exons that partially overlap with the coding sequence .

How should dose-response data for OR51Q1 activation be analyzed?

Proper analysis of dose-response data is critical for characterizing OR51Q1 pharmacology:

  • Curve fitting approach:

    • Fit data to a sigmoidal dose-response model: Y = Bottom + (Top-Bottom)/(1+10^((LogEC50-X)*HillSlope))

    • Use nonlinear regression to determine parameters

    • Calculate 95% confidence intervals for all parameters

  • Parameter interpretation:

    • EC50: Concentration producing 50% of maximal response

    • Efficacy: Maximal response (Top parameter)

    • Basal activity: Response in absence of ligand (Bottom parameter)

    • Hill slope: Steepness of the curve, indicating cooperativity

  • Statistical validation:

    • Compare fitted parameters between experimental conditions

    • Perform extra sum-of-squares F test to determine significant differences

    • Apply appropriate multiple comparison corrections

Agonist criteria validation table:

ParameterCriterionPurpose
Top vs Bottom 95% CINo overlapConfirms significant activation
Log EC50 SD< 1 log unitEnsures reliable potency estimation
F-test vs. controlp < 0.05Verifies specific receptor-mediated effect

What approaches can be used to compare OR51Q1 with other olfactory receptors?

Comparative analysis provides context for OR51Q1 function:

  • Sequence-based comparisons:

    • Phylogenetic analysis to identify closely related receptors

    • Multiple sequence alignment to identify conserved domains

    • Identification of receptor-specific residues

  • Ligand specificity profiling:

    • Cross-screening of OR51Q1 ligands against related receptors

    • Creation of receptor-ligand pairing matrices

    • Analysis of chemical features determining specificity

  • Expression pattern comparison:

    • Tissue distribution analysis across multiple ORs

    • Co-expression with other receptors in specific tissues

    • Correlation of expression patterns with physiological functions

How can I interpret contradictory findings in OR51Q1 research?

Resolving contradictory results requires systematic investigation:

  • Methodological differences:

    • Compare expression systems used (mammalian cells vs. yeast)

    • Analyze assay sensitivity and dynamic range

    • Evaluate receptor construct designs (tags, fusion proteins)

  • Experimental conditions:

    • Compare buffer compositions, pH, temperature

    • Examine compound solubility and vehicle effects

    • Assess incubation times and measurement windows

  • Data analysis approaches:

    • Review normalization methods

    • Compare statistical thresholds for "positive" results

    • Examine raw data distributions for potential artifacts

  • Replication strategy:

    • Design experiments to systematically test conflicting variables

    • Include positive and negative controls from both contradictory studies

    • Consider collaborative validation across different laboratories

What bioinformatic tools are useful for OR51Q1 research?

Several bioinformatic approaches support OR51Q1 research:

  • Sequence analysis tools:

    • BLAST for identifying homologous sequences

    • Clustal Omega for multiple sequence alignments

    • MEGA for phylogenetic analysis

  • Structure prediction software:

    • GPCR-I-TASSER for homology modeling

    • PyMOL for structural visualization

    • AutoDock for ligand docking simulations

  • Expression data resources:

    • Human Protein Atlas for tissue expression patterns

    • GTEx Portal for transcript expression across tissues

    • GEO DataSets for condition-specific expression analysis

  • Machine learning for ligand prediction:

    • Support vector machines for ligand classification

    • Random forests for feature importance analysis

    • Neural networks for complex pattern recognition in chemical features

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.