Recombinant Human Olfactory receptor 52B6 (OR52B6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its inclusion in the production process.
Synonyms
OR52B6; Olfactory receptor 52B6; Olfactory receptor OR11-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR52B6
Target Protein Sequence
MAQVRALHKIMALFSANSIGAMNNSDTRIAGCFLTGIPGLEQLHIWLSIPFCIMYITALE GNGILICVILSQAILHEPMYIFLSMLASADVLLSTTTMPKALANLWLGYSLISFDGCLTQ MFFIHFLFIHSAVLLAMAFDRYVAICSPLRYVTILTSKVIGKIVTAALSHSFIIMFPSIF LLEHLHYCQINIIAHTFCEHMGIAHLSCSDISINVWYGLAAALLSTGLDIMLITVSYIHI LQAVFRLLSQDARSKALSTCGSHICVILLFYVPALFSVFAYRFGGRSVPCYVHILLASLY VVIPPMLNPVIYGVRTKPILEGAKQMFSNLAKGSK
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15211

KEGG: hsa:340980

STRING: 9606.ENSP00000341581

UniGene: Hs.553704

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the standard identifiers and nomenclature for OR52B6?

When conducting literature searches or database queries, researchers should be aware of these key identifiers:

Database/SystemIdentifierDescription
UniProt PrimaryQ8NGF0Primary accession number
UniProt SecondaryQ6IFI7Alternative accession number
NCBI GeneID340980Gene identification number
NCBI Protein AccessionNP_001005162.2Protein reference sequence
Alternative NamesOlfactory receptor OR11-47Common synonym in literature
Chromosomal Location11p15.4Location in human genome
Gene SymbolOR52B6Official gene symbol

How should I design experiments to study OR52B6 function?

Designing robust experiments for OR52B6 requires systematic planning following established experimental design principles:

  • Define Research Variables :

    • Independent Variables: Potential ligands, concentration ranges, environmental conditions

    • Dependent Variables: Receptor activation, signaling pathway activity

    • Extraneous Variables: Expression levels, cell health, temperature, pH

  • Formulate Specific Hypotheses :

    • Null Hypothesis (H0): "Compound X does not activate OR52B6"

    • Alternative Hypothesis (H1): "Compound X activates OR52B6 in a concentration-dependent manner"

  • Design Treatments with Controls :

    • Include positive controls (known GPCR activators)

    • Include negative controls (vehicle, non-transfected cells)

    • Design dose-response experiments for quantitative analysis

  • Subject Assignment :

    • Between-subjects design: Different cell populations for different treatments

    • Within-subjects design: Same cell population for multiple treatments with washout periods

  • Measurement Planning :

    • Select appropriate readouts (calcium flux, cAMP levels, etc.)

    • Determine timing and frequency of measurements

    • Establish quantification methods and analysis parameters

What expression systems are most effective for recombinant OR52B6 production?

Based on the available literature and search results, researchers can consider multiple expression systems:

Expression SystemAdvantagesLimitationsApplications
E. coliHigh yield, cost-effective, established protocolsLimited post-translational modifications, potential improper foldingStructural studies, antibody generation
Mammalian CellsNative-like post-translational modifications, proper foldingLower yield, higher costFunctional assays, trafficking studies
Cell-Free SystemsRapid production, control over reaction environmentVariable protein qualityInitial screening, small-scale studies

For E. coli expression as described in the search results, researchers should note:

  • Recombinant OR52B6 can be produced with an N-terminal His tag

  • The protein expressed in E. coli has demonstrated >90% purity by SDS-PAGE analysis

  • The recombinant protein is typically provided as a lyophilized powder

What are the optimal storage and handling conditions for recombinant OR52B6?

Proper handling of recombinant OR52B6 is critical for maintaining protein integrity and experimental reproducibility:

Storage Conditions:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution Protocol:

  • Centrifuge the vial briefly before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL concentration

  • Add glycerol to 5-50% final concentration for long-term storage (50% is recommended)

Buffer Composition:

  • Standard storage buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

How can I verify the activity and integrity of recombinant OR52B6?

Verification of OR52B6 activity requires multiple complementary approaches:

  • Structural Integrity Assessment:

    • SDS-PAGE to confirm expected molecular weight and purity (>90%)

    • Western blot using specific antibodies or anti-His tag antibodies

    • Circular dichroism to evaluate secondary structure elements

  • Functional Assays:

    • Ligand binding assays

    • G-protein activation measurements

    • Calcium mobilization in cells expressing the receptor

    • cAMP production or inhibition depending on G-protein coupling

  • Quality Control Metrics:

    • Purity should exceed 90% as determined by SDS-PAGE

    • Batch-to-batch consistency in activity measurements

    • Absence of aggregation or degradation products

What experimental approaches can be used to identify ligands for OR52B6?

Ligand identification for olfactory receptors like OR52B6 requires specialized methodologies:

  • High-Throughput Screening Approaches:

    • Calcium imaging in OR52B6-expressing cells

    • BRET/FRET-based assays for conformational changes

    • Label-free dynamic mass redistribution assays

  • Computational Methods:

    • Structure-based virtual screening using homology models

    • Ligand-based approaches utilizing known odorant patterns

    • Machine learning algorithms to predict potential ligands

  • Validation Strategies:

    • Dose-response experiments with candidate ligands

    • Competition binding assays

    • Structure-activity relationship studies

    • Specificity testing against related olfactory receptors

How can I investigate the signaling pathways associated with OR52B6 activation?

Understanding OR52B6 signaling requires systematic investigation of downstream events:

  • G-protein Coupling Determination:

    • [35S]GTPγS binding assays

    • Real-time BRET assays for G-protein recruitment

    • Knockdown/inhibition studies of G-protein subtypes

  • Secondary Messenger Analysis:

    • cAMP measurements using ELISA or biosensors

    • Calcium imaging with fluorescent indicators

    • Inositol phosphate accumulation assays

  • Downstream Signaling Tracking:

    • Phosphorylation of ERK1/2 and other kinases

    • Transcriptional reporter assays

    • Proteomic approaches to identify signaling networks

Data Analysis Approaches:

  • Quantify EC50/IC50 values for signaling responses

  • Evaluate signal kinetics and desensitization patterns

  • Compare signaling profiles across different ligands for biased signaling

What are the most common issues in OR52B6 research and how can they be addressed?

Researchers frequently encounter these challenges when working with OR52B6:

  • Expression and Purification Challenges:

    • Low expression levels

    • Protein aggregation or misfolding

    • Detergent sensitivity

    Solutions:

    • Optimize codon usage for expression host

    • Screen multiple detergents for solubilization

    • Use solubility-enhancing fusion tags

    • Adjust expression temperature and induction conditions

  • Functional Activity Issues:

    • Poor trafficking to cell membrane

    • Limited functional response

    Solutions:

    • Co-express with trafficking chaperones

    • Use receptor activity-enhancing mutations

    • Optimize cell culture conditions

    • Evaluate multiple assay formats for detection sensitivity

  • Data Interpretation Challenges:

    • High background in functional assays

    • Differentiating specific from non-specific effects

    Solutions:

    • Include appropriate negative controls

    • Perform competitive binding experiments

    • Use receptor-specific antagonists when available

    • Implement concentration-response studies

How should contradictory results in OR52B6 studies be reconciled?

When faced with contradictory findings:

  • Systematic Analysis of Methodological Differences :

    • Compare expression systems used (E. coli vs. mammalian)

    • Evaluate assay differences (direct binding vs. functional)

    • Assess buffer compositions and experimental conditions

    • Consider tag interference with protein function

  • Statistical Considerations :

    • Evaluate sample sizes and statistical power

    • Assess variability within and between experiments

    • Consider multiple hypothesis testing corrections

    • Analyze effect sizes rather than just p-values

  • Reproducibility Assessment :

    • Conduct direct replications under identical conditions

    • Perform independent replications by different researchers

    • Use blinded experimental design when possible

    • Share detailed protocols to identify subtle methodology differences

  • Reconciliation Approaches:

    • Meta-analysis of combined datasets

    • Collaborative cross-laboratory validation studies

    • Development of standardized assay protocols

    • Expanded hypothesis development to accommodate seemingly contradictory results

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.