Recombinant Human Olfactory receptor 52E1 (OR52E1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Human Olfactory Receptor 52E1 (OR52E1) is a lab-engineered form of the olfactory receptor protein encoded by the OR52E1 gene in humans. As a member of the G protein-coupled receptor (GPCR) superfamily, OR52E1 is part of the largest multigene family in vertebrates, with roles in odor detection and signal transduction . While endogenous OR52E1 is expressed in tissues beyond the olfactory epithelium, such as sperm cells , its recombinant form enables targeted studies on ligand interactions, structural biology, and physiological roles.

Expression and Localization

  • OR52E1 is detected in human spermatozoa, suggesting roles in chemotaxis or cellular communication .

  • Unlike many olfactory receptors, OR52E1 is not exclusively olfactory-specific and may have ectopic physiological functions .

Ligand Binding and Activation

  • OR52E1 remains an orphan receptor, with no confirmed physiological ligands .

  • Computational models predict interactions with hydrophobic compounds due to its class II (tetrapod-specific) receptor classification .

Signaling Mechanism

Activation follows the GPCR pathway:

  1. Odorant binding induces conformational changes in TM helices.

  2. Gα<sub>olf</sub> protein activates adenylate cyclase, increasing cAMP.

  3. cAMP opens ion channels, depolarizing the cell .

Challenges in OR52E1 Characterization

  • Low Functional Expression: OR52E1, like ~80% of human olfactory receptors, is difficult to express in standard cell lines (e.g., HEK293) .

  • Ligand Discovery: High-throughput screens have not yet identified activators, partly due to insufficient native cellular environments .

Future Directions

  1. Structural Resolution: Cryo-EM studies could reveal atomic-level details of OR52E1’s binding pocket, analogous to OR51E2 .

  2. Ligand Deorphanization: Advanced screening in LNCaP or olfactory neuron-derived cells may improve success rates .

  3. Physiological Roles: Investigate non-olfactory functions in sperm motility or airway epithelial responses .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will accommodate your needs to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. We recommend contacting your local distributors for specific delivery time estimates.
All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR52E1; OR52E1P; Olfactory receptor 52E1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR52E1
Target Protein Sequence
MNTTLFHPYSFLLLGIPGLESMHLWVGFPFFAVFLTAVLGNITILFVIQTDSSLHHPMFY FLAILSSIDPGLSTSTIPKMLGTFWFTLREISFEGCLTQMFFIHLCTGMESAVLVAMAYD CYVAICDPLCYTLVLTNKVVSVMALAIFLRPLVFVIPFVLFILRLPFCGHQIIPHTYGEH MGIARLSCASIRVNIIYGLCAISILVFDIIAIVISYVQILCAVFLLSSHDARLKAFSTCG SHVCVMLTFYMPAFFSFMTHRFGRNIPHFIHILLANFYVVIPPALNSVIYGVRTKQIRAQ VLKMFFNK
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 14766

KEGG: hsa:79296

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of OR52E1 and how does it compare to other olfactory receptors?

OR52E1 belongs to the large family of G-protein-coupled receptors (GPCRs) characterized by a 7-transmembrane domain structure shared with many neurotransmitter and hormone receptors. Like other olfactory receptors, OR52E1 is encoded by a single coding-exon gene and participates in the recognition and G protein-mediated transduction of odorant signals . The protein structure follows the typical GPCR architecture with an extracellular N-terminus, seven membrane-spanning domains connected by alternating intracellular and extracellular loops, and an intracellular C-terminus that interacts with G proteins to initiate signaling cascades when an odorant binds.

Structurally, OR52E1 shares the common features of the olfactory receptor family while maintaining sequence specificity that determines its unique ligand binding profile. Comparative analyses with other olfactory receptors such as OR51E2 can provide insights into structural determinants of ligand specificity and signaling properties.

Where is OR52E1 primarily expressed in human tissues?

While the provided search results don't specifically detail OR52E1 expression patterns, olfactory receptors are known to exhibit ectopic expression outside the nasal epithelium. For instance, OR51E2, another member of the olfactory receptor family, has been detected at both transcript and protein levels in human epidermal melanocytes .

To investigate OR52E1 expression, researchers should employ multiple complementary techniques:

  • RT-PCR using specific primers designed for OR52E1 amplification

  • Immunohistochemistry/immunocytochemistry using validated OR52E1-specific antibodies

  • RNA-seq analysis of various tissue types

  • Single-cell RNA sequencing for cellular resolution of expression patterns

Verification of expression should include proper controls and validation across multiple detection methods to account for potential cross-reactivity with related receptors.

How can I validate the specificity of commercially available OR52E1 antibodies?

Antibody validation is crucial for ensuring reliable detection of OR52E1. Recommended validation approaches include:

  • Western blot analysis of tissues or cells with known OR52E1 expression compared with negative controls

  • Peptide competition assays to confirm binding specificity

  • siRNA knockdown of OR52E1 followed by immunodetection to confirm signal reduction

  • Cross-validation using multiple antibodies targeting different epitopes

  • Immunoprecipitation followed by mass spectrometry to confirm target identity

For the polyclonal antibody products like E-AB-32381 , additional validation is necessary due to potential batch variation. Compare results across multiple detection methods and include appropriate positive and negative controls in each experiment.

What are the optimal heterologous expression systems for functional characterization of OR52E1?

Based on research with other olfactory receptors, several expression systems can be considered for OR52E1 functional studies:

Expression SystemAdvantagesLimitationsSpecial Considerations
Hana3A cellsExpress chaperon proteins (RTP1/RTP2), olfactory G-protein; 41% of bioassays use this system May not recapitulate all aspects of native olfactory neuron environmentInclude rho tag for improved surface expression
HEK293 cellsWidely available, easy to transfectMay show different response patterns compared to other systems Consider co-expression of accessory factors
LNCaP cellsHas identified ligands not detected in HEK293 systems Limited to specific applicationsConsider for validation of negative results
Native OSNsMost physiologically relevantTechnical challenges, limited throughputGold standard for confirmation

When selecting an expression system, consider that different systems may produce different results. For instance, some ligands for olfactory receptors were successfully identified in prostate carcinoma cell lines (LNCaP) but not detected when the same receptors were expressed in HEK293 cells . This assay-dependent bias should be carefully considered when interpreting OR52E1 responses.

What functional assays are most appropriate for measuring OR52E1 activation?

Multiple functional assays can be employed to characterize OR52E1 activation:

  • Luciferase reporter assays: The most common approach (41% of bioassays in the literature) , measuring cAMP-dependent signaling

  • Calcium imaging: Enables real-time visualization of receptor activation through Ca²⁺ flux measurements as demonstrated with OR51E2

  • Electrophysiology: Provides high temporal resolution of receptor-mediated currents

  • cAMP accumulation assays: Directly measure second messenger production

  • GTP-γ-S binding assays: Assess G-protein activation

For calcium imaging experiments specifically, researchers should employ ratiometric approaches similar to those used for OR51E2, utilizing excitation at 340 and 380 nm and measuring emission at 510 nm to calculate f340/f380 intensity ratios . Consider including positive controls such as ATP or endothelin-1 to verify cellular responsiveness.

How should I design experiments to identify specific ligands for OR52E1?

Ligand identification requires systematic approaches:

  • Initial screening: Test candidate odorants at standardized concentrations (typically 100-300 μM for initial screens)

  • Dose-response analysis: Determine EC₅₀ values for active compounds

  • Structure-activity relationship studies: Test related compounds to identify pharmacophores

  • Antagonist identification: Screen for compounds that block responses to known agonists

When designing such experiments, critical considerations include:

  • Stereochemistry of test compounds, as enantiomers may elicit different responses

  • Concentration ranges, as olfactory perception depends on concentration and can lead to different qualities of perception

  • Use of appropriate vehicle controls (e.g., DMSO at ≤0.1% v/v to avoid cellular toxicity)

  • Implementation of multiple response readouts to capture different signaling pathways

How can RNA silencing approaches be optimized for studying OR52E1 function?

RNA silencing provides powerful tools for investigating OR52E1 function through loss-of-function studies. Based on successful approaches with other olfactory receptors, the following methodological considerations are crucial:

  • siRNA design: Use specialized siRNA target design tools to generate effective and specific sequences. For reference, successful siRNA targeting of OR51E2 used the sequence 'gctgcctcctgtcatcaat' . Design multiple candidate siRNAs for OR52E1 following similar principles.

  • Delivery optimization: Test various transfection reagents and conditions to maximize knockdown efficiency while minimizing cellular toxicity. Document transfection efficiency using fluorescently labeled control siRNAs.

  • Validation approach:

    • Confirm knockdown at mRNA level using qRT-PCR (with appropriate housekeeping genes like GAPDH)

    • Verify protein reduction through western blotting or immunocytochemistry

    • Include appropriate scrambled siRNA controls (e.g., use sequences with similar nucleotide composition but scrambled order)

  • Functional assessment: Compare responses to known or suspected ligands between knockdown and control cells to quantify the contribution of OR52E1 to observed cellular responses.

  • Rescue experiments: Co-express siRNA-resistant OR52E1 variants to confirm specificity of observed phenotypes.

What signaling pathways are likely activated by OR52E1 and how can they be monitored?

Based on studies of related olfactory receptors, OR52E1 likely couples to multiple signaling pathways that can be monitored through complementary approaches:

Signaling PathwayDetection MethodKey Reagents/ApproachesExpected Timeline
cAMP signalingELISA, FRET-based sensors, luciferase reportersPKA inhibitors (H-89), adenylyl cyclase activators (forskolin)Rapid (seconds to minutes)
Ca²⁺ signalingRatiometric imaging (Fura-2), fluorescent indicatorsCa²⁺ channel blockers (SKF 96365, GdCl₃, BTP2), EGTA for Ca²⁺-free experiments Immediate (milliseconds to seconds)
ERK/MAPK pathwayWestern blot, phospho-specific antibodiesMEK inhibitors (U0126, PD98059)Delayed (minutes to hours)
Transcriptional regulationqRT-PCR, RNA-seqActinomycin D (transcription inhibitor)Long-term (hours to days)

For calcium signaling specifically, researchers should consider both extracellular calcium influx and release from intracellular stores. To differentiate these mechanisms, employ:

  • Thapsigargin to deplete intracellular stores

  • 2-APB to block store-operated calcium entry

  • Calcium-free extracellular solutions with EGTA (50 μM) to chelate residual calcium

How does OR52E1 subcellular localization impact its function and how can this be studied?

Olfactory receptor localization significantly influences function, as seen with other GPCRs where intracellular localization affects signaling outcomes . To investigate OR52E1 localization:

  • Immunocytochemical approaches:

    • Utilize specific OR52E1 antibodies in co-staining experiments with organelle markers

    • Include markers for plasma membrane, endoplasmic reticulum, Golgi apparatus, and endosomes

    • Consider co-immunocytochemical staining with early endosome markers like EEA-1 (early endosome antigen 1), as seen with OR51E2

  • Surface biotinylation:

    • Label cell surface proteins with membrane-impermeable biotinylation reagents

    • Isolate biotinylated proteins using streptavidin beads

    • Detect OR52E1 by western blotting to quantify surface expression

  • Plasma membrane preparations:

    • Isolate plasma membrane fractions through differential centrifugation

    • Analyze OR52E1 content by western blotting

    • Include appropriate markers to confirm fraction purity

  • Trafficking studies:

    • Create OR52E1 fusion constructs with pH-sensitive fluorescent proteins

    • Track receptor movement through different cellular compartments in real-time

    • Determine effects of ligand binding on receptor internalization and recycling

Data interpretation should consider that GPCRs can signal from various subcellular compartments, potentially activating different downstream pathways depending on location.

How can I use the M2OR database to inform OR52E1 research design?

The M2OR (Molecule to Olfactory Receptor) database represents a valuable resource for OR52E1 research planning, containing comprehensive information on OR-molecule experiments . To effectively leverage this resource:

  • Identify potential ligands:

    • Search for molecules that activate receptors with sequence similarity to OR52E1

    • Prioritize testing compounds that interact with multiple receptors in the same subfamily

    • Note both responsive and non-responsive pairs, as M2OR uniquely includes negative results

  • Design concentration ranges:

    • Reference screening concentrations and EC₅₀ values from similar receptors

    • Design dose-response experiments spanning concentration ranges that have been informative for other receptors

  • Select appropriate bioassays:

    • Filter experiments based on assay metadata (cell lines, assay types)

    • Prioritize methodologies with demonstrated success for related receptors

  • Consider stereochemistry:

    • Pay careful attention to stereoisomer information in M2OR

    • Design experiments to test whether OR52E1 shows stereoselectivity like other receptors (e.g., OR1A1)

When interpreting database information, remember that only 6% of OR-molecule pairs tested show agonist activity , suggesting that comprehensive screening approaches are necessary for successful deorphanization of OR52E1.

What are the key considerations for comparing OR52E1 function across species?

Cross-species analysis of OR52E1 requires careful attention to:

  • Sequence homology assessment:

    • Identify true orthologs versus paralogs through phylogenetic analysis

    • Focus on conservation within binding domains and G-protein coupling regions

    • Create multiple sequence alignments to identify species-specific variations

  • Expression pattern comparison:

    • Determine whether expression patterns are conserved across species

    • Consider potential differences in ectopic expression

  • Functional conservation:

    • Test identical ligand panels across species orthologs

    • Compare potency (EC₅₀) and efficacy (maximum response) parameters

    • Identify species-specific ligand preferences

  • Signaling pathway conservation:

    • Assess whether downstream pathways are conserved

    • Compare kinetics and magnitude of signaling responses

  • Physiological relevance:

    • Connect molecular findings to behavioral or physiological differences between species

    • Consider ecological and evolutionary contexts of observed differences

This comparative approach can provide insights into evolutionary conservation and divergence of OR52E1 function, potentially revealing important structure-function relationships.

What are the common challenges in expressing functional OR52E1 and how can they be addressed?

Olfactory receptors, including OR52E1, present several expression challenges:

ChallengeManifestationSolution Strategies
Poor surface expressionLow functional responsesCo-express with RTP1, RTP2, and Ric-8B accessory proteins; Add rho tag to N-terminus; Optimize codon usage
Aggregation in ERProtein visible in lysates but not at cell surfaceCulture at lower temperature (30°C); Add chemical chaperones (e.g., DMSO, glycerol)
Constitutive activityHigh baseline activity masking ligand responsesUse inducible expression systems; Include inverse agonists in assay buffer
CytotoxicityCell death after transfectionReduce expression levels; Use stable cell lines with controlled expression

For heterologous expression, consider using specialized cell lines like Hana3A that express chaperon proteins such as RTP1 or RTP2, olfactory G-protein, and rho tag, which have been successful for other olfactory receptors .

How can I distinguish between specific OR52E1 activation and non-specific cellular responses?

Distinguishing specific from non-specific responses requires rigorous controls:

  • Comparison with mock-transfected cells:

    • Subject control cells to identical treatments and stimulations

    • Subtract any responses observed in control cells from OR52E1-expressing cells

  • Pharmacological validation:

    • Test whether responses are blocked by GPCR antagonists or G-protein inhibitors

    • Include selective inhibitors of downstream signaling pathways

  • Dose-dependency assessment:

    • True agonists typically show characteristic sigmoidal dose-response relationships

    • Non-specific effects often show linear or irregular dose-relationships

  • siRNA knockdown controls:

    • Verify reduction of response after specific OR52E1 knockdown

    • Include scrambled siRNA controls to rule out non-specific effects of transfection

  • Antagonist studies:

    • Identify compounds that block agonist responses at the receptor level

    • Use these as competitive tools to confirm receptor specificity

When analyzing results, remember that odorant concentration significantly influences response patterns. At low concentrations, molecules may not induce cellular responses, while at higher concentrations, they may activate multiple receptors .

What novel applications of OR52E1 research are emerging in biomedical fields?

Based on research with other olfactory receptors, several promising applications may be relevant for OR52E1:

  • Diagnostic biomarkers:

    • Investigate OR52E1 expression in various disease states

    • Evaluate potential as a tissue-specific biomarker if ectopically expressed in specific tissues

  • Therapeutic targeting:

    • Explore whether OR52E1 activation influences cellular homeostasis in tissues where it's expressed

    • Similar to how OR51E2 activation affects melanocyte proliferation and differentiation

  • Drug discovery platforms:

    • Develop OR52E1-based screening systems for identifying novel bioactive compounds

    • Use structure-activity relationships of OR52E1 ligands to design compounds with desired properties

  • Tissue engineering applications:

    • Investigate whether OR52E1 ligands influence cellular differentiation or tissue development

    • Comparable to how synthetic sandalwood compounds accelerate wound healing by activating OR2AT4 in keratinocytes

  • Understanding sensory perception:

    • Connect OR52E1 genetic variations to differences in olfactory perception

    • Contribute to the broader understanding of how genetic diversity in ORs influences sensory experience

As research progresses, functional characterization of OR52E1 may reveal unexpected applications beyond traditional olfactory research.

How can computational approaches enhance OR52E1 research?

Computational methods offer powerful tools for OR52E1 investigation:

  • Homology modeling and molecular dynamics:

    • Generate 3D structural models based on crystal structures of other GPCRs

    • Simulate ligand binding and receptor activation mechanisms

    • Identify key residues for mutagenesis studies

  • Virtual screening:

    • Use in silico docking to predict potential OR52E1 ligands

    • Prioritize compounds for experimental validation

    • Develop machine learning models to predict structure-activity relationships

  • Network analysis:

    • Integrate OR52E1 into protein-protein interaction networks

    • Predict functional associations and signaling pathways

    • Identify potential interacting partners for experimental validation

  • Evolutionary analysis:

    • Trace evolutionary history of OR52E1 across species

    • Identify sites under positive or negative selection

    • Connect sequence variations to functional differences

  • Big data integration:

    • Combine OR52E1 information with data from resources like M2OR

    • Develop predictive models of receptor-ligand interactions

    • Integrate genomic, transcriptomic, and functional data

These computational approaches can generate testable hypotheses and guide experimental design for more efficient OR52E1 characterization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.