Recombinant Human Olfactory receptor 52E8 (OR52E8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please specify it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR52E8; Olfactory receptor 52E8; Olfactory receptor OR11-54
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR52E8
Target Protein Sequence
MAGRMSTSNHTQFHPSSFLLLGIPGLEDVHIWIGVPFFFVYLVALLGNTALLFVIQTEQS LHEPMYYFLAMLDSIDLGLSTATIPKMLGIFWFNTKEISFGGCLSHMFFIHFFTAMESIV LVAMAFDRYIAICKPLRYTMILTSKIISLIAGIAVLRSLYMVVPLVFLLLRLPFCGHRII PHTYCEHMGIARLACASIKVNIRFGLGNISLLLLDVILIILSYVRILYAVFCLPSWEARL KALNTCGSHIGVILAFFTPAFFSFLTHRFGHNIPQYIHIILANLYVVVPPALNPVIYGVR TKQIRERVLRIFLKTNH
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15217

KEGG: hsa:390079

STRING: 9606.ENSP00000444054

UniGene: Hs.553738

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR52E8 and what is its functional role in the human olfactory system?

OR52E8 (Olfactory Receptor Family 52 Subfamily E Member 8) is a G-protein-coupled receptor (GPCR) encoded by the OR52E8 gene in humans. It belongs to the largest mammalian protein superfamily of olfactory receptors that interact with odorant molecules in the nose to initiate neuronal responses triggering smell perception . As part of the OR52 family, it likely responds to medium-to-long chain carboxylic acids, similar to other receptors in this family.

The receptor contains the characteristic 7-transmembrane domain structure common to GPCRs and functions through G-protein-mediated signal transduction of odorant signals . OR52E8 participates in the combinatorial coding of odorants, where each receptor can respond to multiple odorants and each odorant can activate multiple receptors, allowing humans to discriminate thousands of different odors with a relatively limited number of receptors .

What is the genomic context of OR52E8 and how variable is it in human populations?

OR52E8 is located on chromosome 11p15.4 and displays significant copy number variation in human populations. Research using high-resolution microarrays and quantitative PCR identified a 9.5 kb deletion (found in fosmid AC206475) that completely removes the OR52E8 gene in approximately 7% of studied individuals . The population frequency data shows:

OR52E8 VariantPopulation Frequency
Intact gene56%
Pseudogenized (via SNPs)37%
Complete deletion7%

The pseudogenization occurs through specific SNPs (rs12419602 and ss99307947) that can inactivate the gene . This variability contributes to individual differences in olfactory perception capacities.

What are the challenges in expressing recombinant OR52E8 and how can they be overcome?

Expressing functional olfactory receptors in heterologous systems presents significant challenges due to their poor trafficking to the cell surface. For OR52E8, researchers should consider:

  • Expression System Selection: Mammalian cell lines like Hana3A (which expresses accessory proteins) are preferable over standard HEK293T cells for OR expression .

  • Accessory Protein Co-transfection: Co-expression with chaperone proteins such as RTP1, RTP2, and REEP1 significantly enhances surface expression of ORs .

  • N-terminal Modifications: Addition of N-terminal tags like rho tag can improve trafficking to the cell membrane .

  • Codon Optimization: Adapting codon usage to the expression system can improve translation efficiency.

  • Temperature Optimization: Culturing transfected cells at lower temperatures (30-32°C) can improve folding and surface expression.

Recent advances using consensus sequence approaches, as demonstrated with OR52<sup>cs</sup>, may also be applicable to improve OR52E8 expression for structural and functional studies .

How can ligand binding and activation of OR52E8 be measured experimentally?

Several complementary approaches can be used to measure OR52E8 activation:

  • cAMP Assays: Since ORs signal through Golf, resulting in increased cAMP levels, luciferase-based reporter assays that respond to cAMP can measure receptor activation. The database M2OR indicates that 41% of OR bioassays use luciferase reporters in Hana3A cells .

  • Calcium Imaging: Using calcium-sensitive fluorescent dyes to measure intracellular calcium flux upon receptor activation provides real-time monitoring of OR responses.

  • BRET/FRET Assays: These energy transfer techniques can measure protein-protein interactions during signaling.

  • Electrophysiology: Patch-clamp recordings can directly measure electrical responses in cells expressing OR52E8.

  • GTPγS Binding: This assay measures G-protein activation directly.

When conducting these experiments, it's crucial to include proper controls and test multiple concentrations of potential ligands, as odorant responses can be concentration-dependent . Documentation of stereochemistry properties and experimental conditions is essential for reproducibility.

How do copy number variations of OR52E8 affect the functional olfactory receptor repertoire?

Copy number variations (CNVs) of OR52E8 directly impact the functional olfactory receptor repertoire:

The high frequency of the deletion suggests that OR52E8 loss may be tolerated, possibly indicating relaxed selective constraints on certain olfactory receptors in humans compared to other mammals .

What methodology should be used to genotype OR52E8 variants in research participants?

To accurately genotype OR52E8 variants:

  • CNV Detection:

    • Quantitative PCR (qPCR) with primers specific to OR52E8

    • Multiplex Ligation-dependent Probe Amplification (MLPA)

    • Digital PCR for absolute quantification

    • High-resolution microarray analysis

  • SNP Genotyping:

    • TaqMan assays for known SNPs (rs12419602 and ss99307947)

    • Sanger sequencing of the OR52E8 coding region

    • Next-generation sequencing approaches

  • Long-read Sequencing:

    • PacBio or Oxford Nanopore technologies can resolve complex structural variants

  • Data Analysis Considerations:

    • Account for the high sequence similarity between OR family members

    • Design primers unique to OR52E8 to avoid non-specific amplification

    • Include control genes with stable copy numbers

For population studies, it's important to combine methods that can detect both copy number variants and SNPs to fully capture the genetic diversity affecting OR52E8 function .

What is known about the signaling pathway and protein interactions of OR52E8?

OR52E8 functions through the canonical olfactory signaling pathway with several key interacting partners:

Protein PartnerInteraction ScoreFunctional Role
OR52E40.852Another olfactory receptor with potential functional overlap
GNAL (Golf)0.713G-protein mediating signal transduction in olfactory neurons
ARRB20.684Beta-arrestin-2 regulating GPCR signaling and internalization
ARRB1Similar to ARRB2Beta-arrestin-1 with similar regulatory functions

The signaling cascade typically involves:

  • Odorant binding to OR52E8

  • Conformational change activating Golf

  • Stimulation of adenylyl cyclase III

  • cAMP production

  • Opening of cyclic nucleotide-gated channels

  • Membrane depolarization and action potential generation

As a member of the OR52 family, OR52E8 likely shares the activation mechanism observed in OR52<sup>cs</sup>, which involves a large inward movement (7.4 Å) of the extracellular segment of TM6 upon odorant binding, significantly larger than the 2-3 Å TM6 movement seen in non-olfactory class A GPCRs .

How can potential ligands for OR52E8 be identified and validated?

A comprehensive approach to identify and validate OR52E8 ligands includes:

  • Computational Prediction:

    • Homology modeling based on recently solved OR structures (OR52<sup>cs</sup> and OR51E2)

    • Molecular docking of candidate odorants

    • Analysis of binding pocket conservation within the OR52 family

    • Machine learning approaches trained on known OR-odorant pairs from databases like M2OR

  • High-throughput Screening:

    • Testing odorant libraries in cells expressing OR52E8

    • Calcium imaging or cAMP assays for detection

    • Concentration-response curves for promising hits

  • Structural Validation:

    • Site-directed mutagenesis of predicted binding residues

    • Focus on residues conserved in the OR52 family, particularly R265<sup>6.59</sup>, which is critical for carboxylic acid recognition in related receptors

    • Investigate the role of G201<sup>5.39</sup> (if conserved in OR52E8), which is important for carboxyl oxygen interaction in OR52<sup>cs</sup>

  • Physiological Validation:

    • Compare responses in native olfactory neurons vs. heterologous systems

    • Validate at different concentrations, as concentration can affect perception quality

    • Test stereoisomers separately, as some ORs respond differently to enantiomers

Since OR52E8 belongs to the OR52 family, medium-to-long-chain carboxylic acids (C6-C9) would be promising initial candidates to test, based on the ligand preferences of other OR52 family members .

What are the latest approaches for structural characterization of OR52E8?

Recent technological advances have revolutionized the structural characterization of olfactory receptors:

  • Cryo-Electron Microscopy (cryo-EM):

    • Successfully used to solve the structures of OR51E2 and OR52<sup>cs</sup>

    • Requires protein engineering to improve expression and stability

    • May require antibody fragments or nanobodies to stabilize active conformations

  • Protein Engineering Strategies:

    • Consensus sequence approach (as used for OR52<sup>cs</sup>)

    • Thermostabilizing mutations

    • Addition of fusion proteins (T4 lysozyme or BRIL) to improve crystallization

    • Truncation of flexible regions

  • Computational Methods:

    • AlphaFold2 has shown remarkable accuracy for OR structure prediction (1.1 Å RMSD compared to experimental structures of OR52<sup>cs</sup>)

    • Molecular dynamics simulations to study conformational changes

    • QM/MM methods to investigate ligand binding energetics

  • NMR Approaches:

    • Solid-state NMR to study membrane-embedded receptors

    • Solution NMR of receptor fragments or loops

    • 19F-NMR to probe conformational changes

For OR52E8 specifically, the high structural similarity within the OR52 family suggests that the OR52<sup>cs</sup> structure provides an excellent template. The large opening between TM5 and TM6 observed in the apo state of OR52<sup>cs</sup> (14 Å compared to 6-7 Å in most class A GPCRs) and the substantial conformational changes upon activation are likely conserved features in OR52E8.

How can OR52E8 research contribute to understanding human olfactory evolution?

OR52E8 provides a unique window into human olfactory evolution:

  • Human-Specific Deletions:

    • The 9.5 kb deletion affecting OR52E8 is human-derived and absent in chimpanzees

    • This contributes to the documented diminution of the human OR repertoire compared to other primates

  • Balancing Selection:

    • The maintenance of both functional and non-functional OR52E8 alleles suggests possible balancing selection

    • Different variants may provide adaptive advantages in different environments or diets

  • Relaxed Selective Pressure:

    • The high frequency of pseudogenization (37%) and deletion (7%) of OR52E8 supports the hypothesis of relaxed selective constraints on human olfactory genes

    • This may relate to the decreased reliance on olfaction following the acquisition of trichromatic vision in primates

  • Regional Adaptation:

    • Population-specific differences in OR52E8 variants could be investigated for correlations with dietary or environmental factors

    • This could reveal local adaptations to specific odorant environments

  • Functional Compensation:

    • Research into how the olfactory system compensates for OR52E8 loss could reveal redundancy mechanisms in the combinatorial odorant code

    • The close relationship with OR52E4 suggests possible functional overlap as an evolutionary safeguard

Comparative genomic analyses across primates, combined with functional characterization of OR52E8 variants, could provide insights into the evolutionary forces shaping human olfactory perception and the adaptive significance of OR repertoire reductions in humans .

Human Olfactory Receptor 52E8 (OR52E8)

Frequently Asked Questions about Recombinant Human Olfactory Receptor 52E8 (OR52E8)

What is OR52E8 and what is its functional role in the human olfactory system?

OR52E8 (Olfactory Receptor Family 52 Subfamily E Member 8) is a G-protein-coupled receptor (GPCR) encoded by the OR52E8 gene in humans. It belongs to the largest mammalian protein superfamily of olfactory receptors that interact with odorant molecules in the nose to initiate neuronal responses triggering smell perception . As part of the OR52 family, it likely responds to medium-to-long chain carboxylic acids, similar to other receptors in this family.

The receptor contains the characteristic 7-transmembrane domain structure common to GPCRs and functions through G-protein-mediated signal transduction of odorant signals . OR52E8 participates in the combinatorial coding of odorants, where each receptor can respond to multiple odorants and each odorant can activate multiple receptors, allowing humans to discriminate thousands of different odors with a relatively limited number of receptors .

What is the genomic context of OR52E8 and how variable is it in human populations?

OR52E8 is located on chromosome 11p15.4 and displays significant copy number variation in human populations. Research using high-resolution microarrays and quantitative PCR identified a 9.5 kb deletion (found in fosmid AC206475) that completely removes the OR52E8 gene in approximately 7% of studied individuals . The population frequency data shows:

OR52E8 VariantPopulation Frequency
Intact gene56%
Pseudogenized (via SNPs)37%
Complete deletion7%

The pseudogenization occurs through specific SNPs (rs12419602 and ss99307947) that can inactivate the gene . This variability contributes to individual differences in olfactory perception capacities.

What are the challenges in expressing recombinant OR52E8 and how can they be overcome?

Expressing functional olfactory receptors in heterologous systems presents significant challenges due to their poor trafficking to the cell surface. For OR52E8, researchers should consider:

  • Expression System Selection: Mammalian cell lines like Hana3A (which expresses accessory proteins) are preferable over standard HEK293T cells for OR expression .

  • Accessory Protein Co-transfection: Co-expression with chaperone proteins such as RTP1, RTP2, and REEP1 significantly enhances surface expression of ORs .

  • N-terminal Modifications: Addition of N-terminal tags like rho tag can improve trafficking to the cell membrane .

  • Codon Optimization: Adapting codon usage to the expression system can improve translation efficiency.

  • Temperature Optimization: Culturing transfected cells at lower temperatures (30-32°C) can improve folding and surface expression.

Recent advances using consensus sequence approaches, as demonstrated with OR52<sup>cs</sup>, may also be applicable to improve OR52E8 expression for structural and functional studies .

How can ligand binding and activation of OR52E8 be measured experimentally?

Several complementary approaches can be used to measure OR52E8 activation:

  • cAMP Assays: Since ORs signal through Golf, resulting in increased cAMP levels, luciferase-based reporter assays that respond to cAMP can measure receptor activation. The database M2OR indicates that 41% of OR bioassays use luciferase reporters in Hana3A cells .

  • Calcium Imaging: Using calcium-sensitive fluorescent dyes to measure intracellular calcium flux upon receptor activation provides real-time monitoring of OR responses.

  • BRET/FRET Assays: These energy transfer techniques can measure protein-protein interactions during signaling.

  • Electrophysiology: Patch-clamp recordings can directly measure electrical responses in cells expressing OR52E8.

  • GTPγS Binding: This assay measures G-protein activation directly.

When conducting these experiments, it's crucial to include proper controls and test multiple concentrations of potential ligands, as odorant responses can be concentration-dependent . Documentation of stereochemistry properties and experimental conditions is essential for reproducibility.

How do copy number variations of OR52E8 affect the functional olfactory receptor repertoire?

Copy number variations (CNVs) of OR52E8 directly impact the functional olfactory receptor repertoire:

The high frequency of the deletion suggests that OR52E8 loss may be tolerated, possibly indicating relaxed selective constraints on certain olfactory receptors in humans compared to other mammals .

What methodology should be used to genotype OR52E8 variants in research participants?

To accurately genotype OR52E8 variants:

  • CNV Detection:

    • Quantitative PCR (qPCR) with primers specific to OR52E8

    • Multiplex Ligation-dependent Probe Amplification (MLPA)

    • Digital PCR for absolute quantification

    • High-resolution microarray analysis

  • SNP Genotyping:

    • TaqMan assays for known SNPs (rs12419602 and ss99307947)

    • Sanger sequencing of the OR52E8 coding region

    • Next-generation sequencing approaches

  • Long-read Sequencing:

    • PacBio or Oxford Nanopore technologies can resolve complex structural variants

  • Data Analysis Considerations:

    • Account for the high sequence similarity between OR family members

    • Design primers unique to OR52E8 to avoid non-specific amplification

    • Include control genes with stable copy numbers

For population studies, it's important to combine methods that can detect both copy number variants and SNPs to fully capture the genetic diversity affecting OR52E8 function .

What is known about the signaling pathway and protein interactions of OR52E8?

OR52E8 functions through the canonical olfactory signaling pathway with several key interacting partners:

Protein PartnerInteraction ScoreFunctional Role
OR52E40.852Another olfactory receptor with potential functional overlap
GNAL (Golf)0.713G-protein mediating signal transduction in olfactory neurons
ARRB20.684Beta-arrestin-2 regulating GPCR signaling and internalization
ARRB1Similar to ARRB2Beta-arrestin-1 with similar regulatory functions

The signaling cascade typically involves:

  • Odorant binding to OR52E8

  • Conformational change activating Golf

  • Stimulation of adenylyl cyclase III

  • cAMP production

  • Opening of cyclic nucleotide-gated channels

  • Membrane depolarization and action potential generation

As a member of the OR52 family, OR52E8 likely shares the activation mechanism observed in OR52<sup>cs</sup>, which involves a large inward movement (7.4 Å) of the extracellular segment of TM6 upon odorant binding, significantly larger than the 2-3 Å TM6 movement seen in non-olfactory class A GPCRs .

How can potential ligands for OR52E8 be identified and validated?

A comprehensive approach to identify and validate OR52E8 ligands includes:

  • Computational Prediction:

    • Homology modeling based on recently solved OR structures (OR52<sup>cs</sup> and OR51E2)

    • Molecular docking of candidate odorants

    • Analysis of binding pocket conservation within the OR52 family

    • Machine learning approaches trained on known OR-odorant pairs from databases like M2OR

  • High-throughput Screening:

    • Testing odorant libraries in cells expressing OR52E8

    • Calcium imaging or cAMP assays for detection

    • Concentration-response curves for promising hits

  • Structural Validation:

    • Site-directed mutagenesis of predicted binding residues

    • Focus on residues conserved in the OR52 family, particularly R265<sup>6.59</sup>, which is critical for carboxylic acid recognition in related receptors

    • Investigate the role of G201<sup>5.39</sup> (if conserved in OR52E8), which is important for carboxyl oxygen interaction in OR52<sup>cs</sup>

  • Physiological Validation:

    • Compare responses in native olfactory neurons vs. heterologous systems

    • Validate at different concentrations, as concentration can affect perception quality

    • Test stereoisomers separately, as some ORs respond differently to enantiomers

Since OR52E8 belongs to the OR52 family, medium-to-long-chain carboxylic acids (C6-C9) would be promising initial candidates to test, based on the ligand preferences of other OR52 family members .

What are the latest approaches for structural characterization of OR52E8?

Recent technological advances have revolutionized the structural characterization of olfactory receptors:

  • Cryo-Electron Microscopy (cryo-EM):

    • Successfully used to solve the structures of OR51E2 and OR52<sup>cs</sup>

    • Requires protein engineering to improve expression and stability

    • May require antibody fragments or nanobodies to stabilize active conformations

  • Protein Engineering Strategies:

    • Consensus sequence approach (as used for OR52<sup>cs</sup>)

    • Thermostabilizing mutations

    • Addition of fusion proteins (T4 lysozyme or BRIL) to improve crystallization

    • Truncation of flexible regions

  • Computational Methods:

    • AlphaFold2 has shown remarkable accuracy for OR structure prediction (1.1 Å RMSD compared to experimental structures of OR52<sup>cs</sup>)

    • Molecular dynamics simulations to study conformational changes

    • QM/MM methods to investigate ligand binding energetics

  • NMR Approaches:

    • Solid-state NMR to study membrane-embedded receptors

    • Solution NMR of receptor fragments or loops

    • 19F-NMR to probe conformational changes

For OR52E8 specifically, the high structural similarity within the OR52 family suggests that the OR52<sup>cs</sup> structure provides an excellent template. The large opening between TM5 and TM6 observed in the apo state of OR52<sup>cs</sup> (14 Å compared to 6-7 Å in most class A GPCRs) and the substantial conformational changes upon activation are likely conserved features in OR52E8.

How can OR52E8 research contribute to understanding human olfactory evolution?

OR52E8 provides a unique window into human olfactory evolution:

  • Human-Specific Deletions:

    • The 9.5 kb deletion affecting OR52E8 is human-derived and absent in chimpanzees

    • This contributes to the documented diminution of the human OR repertoire compared to other primates

  • Balancing Selection:

    • The maintenance of both functional and non-functional OR52E8 alleles suggests possible balancing selection

    • Different variants may provide adaptive advantages in different environments or diets

  • Relaxed Selective Pressure:

    • The high frequency of pseudogenization (37%) and deletion (7%) of OR52E8 supports the hypothesis of relaxed selective constraints on human olfactory genes

    • This may relate to the decreased reliance on olfaction following the acquisition of trichromatic vision in primates

  • Regional Adaptation:

    • Population-specific differences in OR52E8 variants could be investigated for correlations with dietary or environmental factors

    • This could reveal local adaptations to specific odorant environments

  • Functional Compensation:

    • Research into how the olfactory system compensates for OR52E8 loss could reveal redundancy mechanisms in the combinatorial odorant code

    • The close relationship with OR52E4 suggests possible functional overlap as an evolutionary safeguard

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.