Recombinant Human Olfactory receptor 52M1 (OR52M1)

Shipped with Ice Packs
In Stock

Description

Introduction to Olfactory Receptor 52M1

Olfactory receptor 52M1 (OR52M1) is a protein encoded by the OR52M1 gene in humans. It belongs to the extensive family of olfactory receptors, which are specialized G-protein-coupled receptors (GPCRs) primarily expressed in the olfactory epithelium. OR52M1 is also known by alternative designations including OR11-11 and OR52M1P .

Olfactory receptors function as molecular sensors that interact with odorant molecules in the nasal cavity, initiating neuronal responses that ultimately trigger smell perception. The OR52M1 receptor, like other members of the olfactory receptor family, originates from a single coding-exon gene and exhibits the characteristic seven-transmembrane domain structure shared with many neurotransmitter and hormone receptors .

The olfactory receptor gene family represents the largest gene family in the human genome, with OR52M1 being a specific member of the OR52 subfamily. This receptor participates in the G protein-mediated transduction of odorant signals, converting chemical stimuli from odorant molecules into electrical signals that can be processed by the brain .

Genomic and Proteomic Context

OR52M1 is identified by the UniProt ID Q8NGK5 and consists of 317 amino acids in its full-length form . The receptor belongs to Class II (tetrapod-specific) olfactory receptors, distinguishing it from Class I receptors which share similarities with fish olfactory receptors .

Three-Dimensional Structure

While the specific three-dimensional structure of OR52M1 has not been fully elucidated in the search results, insights can be gained from studies of the OR52 family. Recent cryo-electron microscopy studies of consensus OR52 (OR52cs), a representative of the OR52 family, have revealed important structural features in both ligand-free (apo) and ligand-bound states .

The apo structure of OR52 family receptors shows a notable opening between transmembrane helices 5 and 6. Upon ligand binding, significant conformational changes occur, including inward and outward movements of the extracellular and intracellular segments of transmembrane helix 6, respectively . These structural rearrangements are critical for signal transduction and likely apply to OR52M1 as well.

Expression Systems and Purification

Recombinant human OR52M1 can be produced in various expression systems, with E. coli being a common choice for initial studies. According to available data, full-length human OR52M1 protein has been successfully expressed in E. coli with an N-terminal His tag .

The recombinant protein production process typically involves:

  1. Gene cloning into an appropriate expression vector

  2. Transformation of the expression host (e.g., E. coli)

  3. Induction of protein expression

  4. Cell lysis and protein extraction

  5. Purification using affinity chromatography (leveraging the His tag)

  6. Quality control assessments including purity verification using SDS-PAGE

Signal Transduction Mechanism

Like other olfactory receptors, OR52M1 functions through G-protein-coupled signal transduction pathways. Upon binding of an odorant molecule, the receptor undergoes conformational changes that activate associated G proteins, initiating an intracellular signaling cascade .

The binding of odorants to OR52M1 likely triggers the following sequence of events:

  1. Conformational change in the receptor structure

  2. Activation of Golf (a specialized G protein in olfactory neurons)

  3. Stimulation of adenylyl cyclase

  4. Increase in cAMP concentration

  5. Opening of cyclic nucleotide-gated ion channels

  6. Membrane depolarization

  7. Generation of action potentials

  8. Signal transmission to the olfactory bulb

Scientific Research Applications

Recombinant OR52M1 serves as a valuable tool for various scientific investigations, including:

  1. Structural studies: Determining the three-dimensional structure of olfactory receptors and understanding conformational changes upon ligand binding.

  2. Ligand screening: Identifying novel odorants that interact with OR52M1, which can enhance our understanding of olfactory perception.

  3. Signal transduction analysis: Investigating the molecular mechanisms of olfactory signal transduction and the role of specific receptor domains.

  4. Functional expression studies: Understanding the expression patterns of OR52M1 in different tissues and under various conditions.

Detection and Quantification Methods

ELISA (Enzyme-Linked Immunosorbent Assay) kits have been developed for the detection and quantification of OR52M1 in various sample types, including cell culture supernatant, plasma, serum, and tissue homogenates .

Table 2: Specifications of OR52M1 ELISA Kit

ParameterSpecification
Detection Range50-1000 pg/mL
Minimum Detection Limit50 pg/mL
Sensitivity1.0 pg/mL
Method TypeCompetition ELISA
Sample TypesCell Culture Supernatant, Plasma, Serum, Tissue Homogenate
Analytical MethodQuantitative

These detection methods enable researchers to study OR52M1 expression levels and dynamics in various biological contexts .

Recent Advances

Recent structural studies of the OR52 family have significantly advanced our understanding of olfactory receptor function. The determination of cryo-electron microscopy structures in both ligand-free and ligand-bound states has provided unprecedented insights into the molecular mechanisms of odorant binding and receptor activation .

These studies have revealed important structural features including:

  1. A large opening between transmembrane helices 5 and 6 in the apo state

  2. Significant inward and outward movements of transmembrane helix 6 segments upon activation

  3. Specific molecular interactions involved in ligand recognition and binding

Future Research Directions

Future research on OR52M1 could explore several promising directions:

  1. Detailed structural analysis: Determining the high-resolution structure of OR52M1 specifically, rather than relying on family representatives, could provide more precise insights into its function.

  2. Ligand identification: Discovering the specific odorants that activate OR52M1 would enhance our understanding of its role in olfactory perception.

  3. Non-olfactory functions: Investigating potential roles of OR52M1 in non-olfactory tissues, as olfactory receptors have been detected in unexpected locations such as skin .

  4. Therapeutic applications: Exploring the potential of OR52M1 as a drug target or diagnostic marker based on its expression patterns and functions.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time information.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. The shelf life of lyophilized protein is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please inform us, and we will strive to incorporate it preferentially.
Synonyms
OR52M1; OR52M1P; Olfactory receptor 52M1; Olfactory receptor OR11-11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR52M1
Target Protein Sequence
MLTFHNVCSVPSSFWLTGIPGLESLHVWLSIPFGSMYLVAVVGNVTILAVVKIERSLHQP MYFFLCMLAAIDLVLSTSTIPKLLGIFWFGACDIGLDACLGQMFLIHCFATVESGIFLAM AFDRYVAICNPLRHSMVLTYTVVGRLGLVSLLRGVLYIGPLPLMIRLRLPLYKTHVISHS YCEHMAVVALTCGDSRVNNVYGLSIGFLVLILDSVAIAASYVMIFRAVMGLATPEARLKT LGTCASHLCAILIFYVPIAVSSLIHRFGQCVPPPVHTLLANFYLLIPPILNPIVYAVRTK QIRESLLQIPRIEMKIR
Uniprot No.

Target Background

Function
Odorant receptor.
Gene References Into Functions
  1. This publication uses 'GPR135' as a name for this gene. PMID: 12732197
Database Links

HGNC: 15225

KEGG: hsa:119772

STRING: 9606.ENSP00000353343

UniGene: Hs.553567

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR52M1 and what is its function in human olfaction?

OR52M1 (Olfactory receptor 52M1) is a protein encoded by the OR52M1 gene in humans. It belongs to the olfactory receptor family, which functions as the primary molecular interface between environmental odorants and the olfactory sensory system. Like other olfactory receptors, OR52M1 interacts with specific odorant molecules in the nasal epithelium to initiate neuronal responses that trigger smell perception .

The receptor is a member of the G-protein-coupled receptor (GPCR) superfamily characterized by a 7-transmembrane domain structure. Upon odorant binding, OR52M1 undergoes conformational changes that activate G protein-mediated signal transduction pathways, ultimately leading to action potentials transmitted to the olfactory bulb in the brain .

What alternative nomenclature exists for OR52M1 in research literature?

When conducting literature searches or database queries, researchers should be aware of several alternative designations for OR52M1:

Alternative DesignationDatabase Reference
OR11-11GenBank, UniProt
OR52M1PNCBI, Ensembl
OR52M3PNCBI, Ensembl

These alternative names appear in various genomic databases and research publications, and searching with all variants will ensure comprehensive literature coverage .

How is OR52M1 structurally characterized compared to other olfactory receptors?

OR52M1 shares the canonical structural organization of the olfactory receptor family, featuring seven transmembrane domains characteristic of class A GPCRs. The protein contains both highly conserved motifs common to all olfactory receptors and variable regions that determine its odorant specificity.

The receptor's structure incorporates:

  • An extracellular N-terminus involved in initial odorant recognition

  • Seven transmembrane α-helical domains forming the receptor core

  • Three extracellular loops and three intracellular loops connecting the transmembrane regions

  • An intracellular C-terminus involved in G protein coupling and downstream signaling

This structural architecture is evolutionarily conserved across the olfactory receptor family, which constitutes the largest gene family in the mammalian genome .

What expression systems are most effective for producing functional recombinant OR52M1?

Based on successful approaches with other olfactory receptors, researchers should consider the following expression systems for recombinant OR52M1 production:

Expression SystemAdvantagesChallenges
Mammalian cell lines (HEK293, CHO)Native-like post-translational modifications; proper foldingLower yields; higher cost
Insect cells (Sf9, Hi5)Higher expression levels; eukaryotic processingComplex media requirements
Cell-free systemsRapid production; avoids toxicity issuesMay require optimization for membrane proteins

Cell-free expression systems have shown promise for olfactory receptor production, as evidenced by successful approaches with other olfactory receptors . When designing expression constructs, consider incorporating:

  • N-terminal signal sequences to direct membrane insertion

  • Fusion tags to enhance solubility (MBP, SUMO)

  • Affinity tags for purification (His6, FLAG)

  • Fluorescent protein fusions for localization studies

Codon optimization for the chosen expression system is critical for improving yields of this complex transmembrane protein.

What purification strategies maximize yield and activity of recombinant OR52M1?

Purification of functional OR52M1 requires careful consideration of membrane protein biochemistry. A methodological approach should include:

  • Membrane isolation: Differential centrifugation following cell lysis

  • Detergent screening: Systematic evaluation of detergents for solubilization

    • Mild detergents (DDM, LMNG) often preserve GPCR functionality

    • Detergent concentration optimization is critical

  • Affinity chromatography: Utilizing engineered affinity tags

  • Size exclusion chromatography: For removing aggregates and ensuring monodispersity

To assess purification success, implement quality control measures:

  • SDS-PAGE and western blotting to confirm identity

  • Circular dichroism to verify secondary structure integrity

  • Thermal stability assays to evaluate protein folding

  • Binding assays with known ligands when available

The choice of detergent is particularly crucial, as it must maintain the native conformation of the seven transmembrane domains while solubilizing the receptor from the membrane environment.

What experimental approaches can verify the functional activity of recombinant OR52M1?

Confirming that recombinant OR52M1 retains native functionality requires multiple complementary approaches:

Assay TypeMethodologyData Output
Ligand bindingFluorescence-based competitive bindingBinding affinity (Kd, Ki)
G protein coupling[35S]GTPγS binding assayG protein activation kinetics
Calcium mobilizationFLIPR or calcium-sensitive dyesSignaling efficacy (EC50)
cAMP productionBRET/FRET-based sensorsDose-response relationships
Receptor traffickingImmunofluorescence microscopySubcellular localization

When designing these experiments, include appropriate controls:

  • Empty vector controls

  • Well-characterized olfactory receptors

  • Constitutively active and inactive receptor mutants

The integration of multiple functional assays provides more robust evidence of recombinant receptor activity than any single methodology .

How can researchers identify potential ligands for OR52M1?

Given the limited knowledge about OR52M1's specific odorant preferences, systematic ligand identification approaches include:

  • Computational screening:

    • Homology modeling based on related olfactory receptors

    • Virtual screening of odorant libraries

    • Molecular docking simulations to predict binding interactions

  • High-throughput screening:

    • Odorant libraries organized by chemical class

    • Functional assays measuring calcium flux or cAMP production

    • Dose-response characterization of hits

  • Structure-activity relationship studies:

    • Testing structural analogs of identified hits

    • Defining pharmacophore features important for binding

    • Iterative refinement of lead compounds

Network-based approaches can also help predict potential ligands based on structural similarities with other characterized olfactory receptors . Current knowledge indicates OR52M1 remains functionally uncharacterized, with few or no known ligands definitively identified .

How can OR52M1 be integrated into broader olfactory receptor network studies?

OR52M1 can serve as a valuable component in systems-level analyses of olfactory perception. Methodological approaches include:

  • Network construction and analysis:

    • Co-expression network analysis to identify functionally related receptors

    • Protein-protein interaction networks to map signaling pathways

    • Comparative analysis across species to identify evolutionary patterns

  • Functional genomics approaches:

    • CRISPR-Cas9 modification to generate knockouts/knockins

    • RNA-seq to characterize transcriptional changes upon receptor activation

    • ChIP-seq to identify transcription factors regulating OR52M1 expression

  • Multi-omics integration:

    • Combining proteomics, transcriptomics, and metabolomics data

    • Pathway analysis to position OR52M1 in olfactory signaling networks

    • Machine learning approaches to predict functional relationships

Network-based protein function prediction methods may help elucidate OR52M1's role within the larger olfactory receptor family, particularly given the limited direct experimental data currently available .

What challenges exist in correlating in vitro findings with in vivo OR52M1 function?

Translating recombinant protein studies to physiological understanding presents several methodological challenges:

ChallengeMethodological ApproachConsiderations
Receptor expression levelsQuantitative PCR, RNAscopeNatural expression is often low
Cell-type specific functionSingle-cell transcriptomicsHeterogeneity of olfactory neurons
Combinatorial codingCalcium imaging in tissue slicesMultiple receptors may respond to same odorant
Signal integrationElectrophysiologyFrom molecular events to perception

Researchers should implement controlled experiments that bridge in vitro and in vivo systems:

  • Heterologous expression in olfactory neuron cultures

  • Ex vivo nasal tissue explants

  • Transgenic animal models with modified OR52M1 expression

  • Human psychophysical testing with identified ligands

These approaches help establish the biological relevance of findings from recombinant protein studies.

How should researchers address potential artifacts in OR52M1 functional assays?

When working with recombinant OR52M1, several technical issues can confound data interpretation:

  • Non-specific binding artifacts:

    • Implement multiple washing steps in binding assays

    • Use competitive displacement to confirm specificity

    • Include negative control receptors

  • Expression variability:

    • Normalize functional data to receptor expression levels

    • Use inducible expression systems for controlled studies

    • Implement internal controls for each experimental batch

  • Detergent interference:

    • Screen multiple detergents at various concentrations

    • Validate activity in membrane environments where possible

    • Consider nanodiscs or other membrane mimetics

  • Statistical analysis guidelines:

    • Perform at least three independent experiments

    • Apply appropriate statistical tests for the data distribution

    • Consider blinded analysis for subjective measurements

Careful validation through multiple methodological approaches and rigorous controls helps distinguish genuine OR52M1 activity from technical artifacts .

What bioinformatic resources are available for OR52M1 research?

Several databases and computational tools can support OR52M1 research:

Resource TypeExamplesResearch Application
Genomic databasesNCBI Gene, EnsemblGene structure and variants
Protein databasesUniProt, PharosSequence and annotation data
Structural resourcesGPCRDB, PDBStructural modeling templates
Gene expressionGTEx, Human Protein AtlasTissue expression patterns
Olfactory-specificOlfactionDB, HORDEOlfactory receptor annotations

The Pharos database classifies OR52M1 as a target with limited knowledge (Tdark classification), indicating opportunities for novel discoveries. Current knowledge values for OR52M1 include protein domain (0.58/1.0), cell type/tissue expression (0.54/1.0), and cell line information (0.45/1.0) .

When using these resources, researchers should be aware of annotation quality differences and cross-reference information across multiple databases to ensure accuracy.

How might OR52M1 research contribute to understanding olfactory disorders?

Investigating OR52M1 may provide insights into several olfactory system dysfunctions:

  • Specific anosmia:

    • Genetic association studies between OR52M1 variants and odor perception

    • Functional characterization of natural variants

    • Population-based phenotype-genotype correlations

  • Olfactory receptor compensation mechanisms:

    • Expression changes in response to receptor dysfunction

    • Network-level adaptations in olfactory sensory neurons

    • Plasticity in olfactory signal processing

  • Therapeutic targeting opportunities:

    • Identification of compounds that modulate OR52M1 function

    • Development of receptor-specific antibodies for research

    • Gene therapy approaches for receptor dysfunction

Detailed molecular characterization of OR52M1 and its variants can contribute to the broader understanding of mechanisms underlying olfactory disorders, which affect approximately 5% of the general population.

What interdisciplinary approaches could advance OR52M1 research?

Progress in OR52M1 characterization will likely accelerate through interdisciplinary methodologies:

  • Structural biology integration:

    • Cryo-EM for membrane-embedded receptor visualization

    • HDX-MS for conformational dynamics studies

    • NMR for ligand binding site mapping

  • Neuroscience approaches:

    • Optogenetic control of OR52M1-expressing neurons

    • In vivo calcium imaging during odorant exposure

    • Connectomics of OR52M1 neuronal circuits

  • Computational biology advancements:

    • Molecular dynamics simulations of receptor-odorant interactions

    • Machine learning for ligand prediction

    • Network analysis of olfactory coding

These interdisciplinary approaches can help overcome the current knowledge limitations regarding OR52M1, which has a limited research footprint compared to more extensively studied olfactory receptors .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.