Recombinant Human Olfactory receptor 52N1 (OR52N1)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

OR52N1 is a class II olfactory receptor expressed in humans, localized to chromosome 11p15.4 . As a GPCR, it features seven transmembrane domains and interacts with odorant molecules to activate intracellular signaling via G-proteins . Recombinant versions are synthesized for in vitro studies to bypass challenges in native receptor isolation .

Functional Characteristics

  • Ligand Interaction: OR52N1 responds to specific odorants, though its exact ligands remain under investigation .

  • Signaling Pathway: Activation triggers cAMP or Ca²⁺ flux via Gα<sub>olf</sub> proteins .

  • Tissue Localization: Detected in olfactory epithelium and non-olfactory tissues (e.g., small intestine) .

Research Applications

Recombinant OR52N1 is used in:

  • Ligand Screening: Identifying agonists/antagonists in odorant libraries .

  • Antibody Development: As an immunogen for polyclonal antibodies (e.g., Rabbit IgG) .

  • Functional Assays:

    • Luciferase-based GPCR activation tests in Hana3A or HEK293 cells .

    • ELISA for quantitative measurement (detection range: 0.156–10 ng/ml) .

Key Research Findings

  • Evolutionary Conservation: OR52N1 shares 48% sequence identity with murine orthologs, suggesting conserved roles in chemosensation .

  • Pseudogenization: ~52% of human OR genes are pseudogenes, but OR52N1 remains functional .

  • Assay Sensitivity: Response profiles vary with cell line (e.g., Hana3A vs. HEK293) .

Challenges and Limitations

  • Expression Difficulties: Requires chaperones (e.g., RTP1/2) for proper membrane localization .

  • Ligand Specificity: Low-throughput assays limit deorphanization efforts .

Future Directions

  • High-Throughput Screening: Integration with databases like M2OR to map OR52N1-odorant pairs .

  • Structural Studies: Cryo-EM to resolve ligand-binding domains for drug design .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: All protein shipments are standardly packaged with blue ice packs. For dry ice shipping, please contact us in advance for arrangements, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms exhibit a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize developing it accordingly.
Synonyms
OR52N1; Olfactory receptor 52N1; Olfactory receptor OR11-61
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-320
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR52N1
Target Protein Sequence
MSFLNGTSLTPASFILNGIPGLEDVHLWISFPLCTMYSIAITGNFGLMYLIYCDEALHRP MYVFLALLSFTDVLMCTSTLPNTLFILWFNLKEIDFKACLAQMFFVHTFTGMESGVLMLM ALDHCVAICFPLRYATILTNSVIAKAGFLTFLRGVMLVIPSTFLTKRLPYCKGNVIPHTY CDHMSVAKISCGNVRVNAIYGLIVALLIGGFDILCITISYTMILQAVVSLSSADARQKAF STCTAHFCAIVLTYVPAFFTFFTHHFGGHTIPLHIHIIMANLYLLMPPTMNPIVYGVKTR QVRESVIRFFLKGKDNSHNF
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 14853

KEGG: hsa:79473

STRING: 9606.ENSP00000322823

UniGene: Hs.690209

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is OR52N1 and what is its genomic classification?

    OR52N1 (olfactory receptor family 52 subfamily N member 1) is a member of the G-protein coupled receptor superfamily involved in odorant detection. The "52" in its name represents the phylogenetic family it belongs to, "N" indicates its subfamily, and "1" designates it as the first member identified in this subfamily . Located on Chromosome 11 in humans, it belongs to a gene family that comprises approximately 400 functional genes in humans (compared to 1400 in mice) . Like other olfactory receptors, OR52N1 is a seven-transmembrane domain protein that initiates signal transduction when odorant molecules bind to it. The gene is intronless in its coding region, which is a characteristic feature of the olfactory receptor gene family, making it amenable to direct genomic PCR amplification for research purposes .

  • How does OR52N1 function in the olfactory signaling cascade?

    OR52N1 functions through a well-characterized G-protein coupled signaling pathway that converts chemical signals from odorants into electrical signals in neurons. When an odorant molecule binds to OR52N1, the receptor undergoes conformational changes that activate an olfactory-specific G protein (Golf and/or Gs) . The activated G protein stimulates adenylate cyclase, which converts ATP into cyclic AMP (cAMP). Increased cAMP levels trigger the opening of cyclic nucleotide-gated ion channels, allowing calcium and sodium ions to enter the cell . This influx of ions depolarizes the olfactory receptor neuron, initiating an action potential that transmits the signal to the brain. The binding affinity between OR52N1 and different odorants varies, contributing to the combinatorial coding system that allows humans to distinguish thousands of different odors with a limited number of receptors .

  • What is the protein structure of OR52N1 and its key functional domains?

    OR52N1, like other olfactory receptors, features a structure typical of class A rhodopsin-like GPCRs with seven transmembrane (TM) domains connected by alternating intracellular and extracellular loops . While the exact structure of OR52N1 hasn't been fully determined experimentally, comparative sequence analysis with other olfactory receptors reveals conserved sequence motifs that serve as signatures of this gene family . Most of the sequence variability is observed in extracellular loops EC1 and EC3, membrane-spanning domains TM4, TM5, and to a lesser degree TM3 and TM6, as well as in the extreme amino and carboxyl termini . These variable regions are believed to be involved in ligand recognition and binding specificity. Current models suggest approximately 20 variable amino acid residues on transmembrane helices 3, 4, and 5 constitute the putative ligand "complementarity-determining region," though additional domains including TM6 and extracellular loops also contribute to odorant binding specificity .

  • What are the recommended expression systems for recombinant OR52N1?

    Based on established protocols for olfactory receptors, several expression systems can be employed for recombinant OR52N1 production, each with distinct advantages:

    Expression SystemAdvantagesChallengesApplications
    Cell-free systemRapid production, avoids toxicity issues, ≥85% purity achievableMay require optimization for proper foldingStructural studies, biochemical characterization
    HEK293/HEK293TMammalian post-translational modifications, widely accessibleLower expression levelsFunctional assays, ligand screening
    Hana3A cellsEngineered specifically for ORs with chaperon proteins (RTP1/RTP2), olfactory G-protein and rho tagSpecialized systemLuciferase reporter assays, most reliable for functional studies
    Insect cells (Sf9)Higher yields for membrane proteinsDifferent glycosylation patternsStructural studies, protein production
    YeastHigh yields, eukaryotic processingDifferent membrane environmentMass production for antibody generation

    For functional studies involving ligand identification, Hana3A cells are particularly advantageous as they express accessory proteins that facilitate proper receptor trafficking to the cell membrane . For structural studies requiring larger quantities of purified protein, cell-free expression systems have proven effective, yielding recombinant olfactory receptors with ≥85% purity suitable for SDS-PAGE analysis .

  • How can the purity and integrity of recombinant OR52N1 be assessed?

    Multiple complementary methods should be employed to assess both the purity and structural integrity of recombinant OR52N1:

    • Purity assessment: SDS-PAGE analysis is the primary method to evaluate protein purity, with ≥85% purity typically achievable for recombinant olfactory receptors . Western blotting using OR52N1-specific antibodies or antibodies against included tags (His, FLAG, Rho1D4) confirms protein identity and can detect degradation products.

    • Structural integrity: Circular dichroism spectroscopy can confirm the expected alpha-helical content characteristic of seven-transmembrane GPCRs. Thermal stability assays using differential scanning fluorimetry provide information about protein folding and stability.

    • Functional assessment: The ultimate test of proper folding is functional activity, which can be evaluated through ligand binding assays or activation assays. For olfactory receptors, luciferase reporter assays in heterologous expression systems represent 41% of bioassay results in the literature and are considered a gold standard for functional validation .

    • Mass spectrometry: Liquid chromatography-mass spectrometry (LC-MS) can verify the molecular weight and sequence of the purified protein, while hydrogen-deuterium exchange mass spectrometry (HDX-MS) can provide insights into protein dynamics and conformational states.

Experimental Design Considerations

  • What are the optimal storage and handling conditions for recombinant OR52N1?

    Proper storage and handling are crucial for maintaining OR52N1 activity:

    • Short-term storage (up to one week): Store working aliquots at 4°C in appropriate buffer to minimize freeze-thaw cycles .

    • Medium-term storage: Store at -20°C in buffer containing 50% glycerol as a cryoprotectant .

    • Long-term storage: Store at -80°C for extended preservation. For recombinant olfactory receptors, Tris-based buffer with 50% glycerol is typically recommended .

    • Critical considerations:

      1. Avoid repeated freeze-thaw cycles which significantly reduce protein activity

      2. Store in small aliquots to minimize freeze-thaw events

      3. Include protease inhibitors in storage buffers to prevent degradation

      4. Consider adding stabilizing agents such as glycerol or specific ligands

      5. Monitor protein stability regularly with functional or binding assays

    • Transportation: Ship on dry ice for frozen samples or with ice packs for samples stored at 4°C. Include temperature monitoring if possible.

    • Quality control: Before experimental use, verify protein integrity by SDS-PAGE and functional activity using established assays to ensure consistent results.

  • What controls should be included in functional assays of recombinant OR52N1?

    Robust experimental design requires appropriate controls:

    • Negative controls:

      1. Mock-transfected cells (vector only) to control for endogenous responses

      2. Cells expressing OR52N1 without ligand stimulation to establish baseline activity

      3. Cells expressing an unrelated olfactory receptor to control for non-specific effects

      4. Vehicle controls (solvent used for odorant dilution) to account for solvent effects

    • Positive controls:

      1. Well-characterized receptor-ligand pairs (e.g., OR1A1 with citronellal) to validate assay performance

      2. OR52N1 with a verified agonist once identified

      3. Direct activation of downstream signaling components (e.g., forskolin for cAMP production)

    • Technical controls:

      1. Multiple technical replicates (typically 3-4) for each condition

      2. Multiple biological replicates using different batches of cells and protein

      3. Dose-response curves rather than single-concentration measurements

      4. Time-course measurements to capture kinetic responses

    • Validation across methods:

      1. Confirm key findings using different assay readouts (e.g., cAMP measurement and calcium imaging)

      2. Verify results in different expression systems when possible

      3. Use both gain-of-function and loss-of-function approaches (agonists and antagonists)

  • How can researchers quantitatively analyze OR52N1 responses to odorants?

    Quantitative analysis of OR52N1 responses requires rigorous methodologies:

    • Dose-response analysis:

      1. Test compounds across a wide concentration range (typically 10⁻⁹ to 10⁻³ M)

      2. Fit data to appropriate models (usually sigmoidal dose-response curve)

      3. Calculate key parameters: EC₅₀ (potency), Eₘₐₓ (efficacy), Hill coefficient (cooperativity)

      4. Compare parameters statistically across compounds and receptor variants

    • Normalization approaches:
      Different normalization methods yield different insights:

      1. Normalization to receptor baseline (norm_rec) - reveals receptor-specific effects

      2. Normalization to a reference pair (norm_pair) - allows comparison between receptors

      3. Normalization to positive control (e.g., forskolin response) - accounts for cell variability

    • Statistical analysis:

      1. Apply appropriate statistical tests (ANOVA, t-tests) with corrections for multiple comparisons

      2. Report both effect sizes and p-values

      3. Consider variability between replicates and experiments

      4. Use robust statistics when data show non-normal distribution

    • Data visualization:

      1. Present full dose-response curves rather than single points

      2. Use error bars representing standard deviation or standard error

      3. Consider heat maps for comparing responses across multiple receptors and ligands

      4. Use principal component analysis for visualizing patterns in multivariate response data

  • What considerations are important when designing mutation studies for OR52N1?

    Mutation studies require careful design and interpretation:

    • Mutation selection strategies:

      1. Systematic approaches: Alanine scanning of transmembrane domains or specific loops

      2. Hypothesis-driven: Target conserved motifs or predicted binding sites

      3. Comparative approach: Introduce residues from related receptors with different specificities

      4. Polymorphism-based: Investigate naturally occurring variants

    • Types of mutations to consider:

      1. Conservative substitutions: Maintain similar physicochemical properties

      2. Non-conservative substitutions: Change charge, size, or hydrophobicity

      3. Domain swapping: Exchange entire loops or transmembrane regions between receptors

      4. Deletion/insertion mutations: Test the role of specific sequence lengths

    • Functional characterization:

      1. Assess expression levels and membrane localization before functional testing

      2. Compare wild-type and mutant dose-response curves with multiple ligands

      3. Determine if mutations affect binding affinity (EC₅₀) or efficacy (Eₘₐₓ)

      4. Test both agonists and antagonists to fully characterize mutant phenotypes

    • Structural interpretation:

      1. Map mutations onto homology models

      2. Use molecular dynamics to predict how mutations affect receptor dynamics

      3. Compare results with mutations in analogous positions in related GPCRs

      4. Consider both direct effects on ligand binding and indirect effects on receptor activation

  • What are the recommended methods for studying OR52N1 expression patterns in human tissues?

    Investigating OR52N1 expression patterns requires sensitive and specific techniques:

    • mRNA detection methods:

      1. RT-qPCR: Quantitative analysis of OR52N1 transcripts in tissue samples

      2. RNA-Seq: Transcriptome-wide approach for comparative expression analysis

      3. Single-cell RNA-Seq: Identifies cell-type specific expression patterns

      4. In situ hybridization: Localizes OR52N1 expression in tissue sections

    • Protein detection methods:

      1. Immunohistochemistry/immunofluorescence: Localizes OR52N1 protein in tissues

      2. Western blotting: Confirms protein expression and size

      3. Flow cytometry: Quantifies OR52N1-expressing cells in dissociated tissues

      4. Mass spectrometry: Identifies OR52N1 in complex protein mixtures

    • Critical considerations:

      1. Antibody validation: Thoroughly validate antibody specificity due to high sequence similarity among ORs

      2. Primer design: Design highly specific primers that distinguish OR52N1 from related receptors

      3. Positive controls: Include tissues known to express olfactory receptors (olfactory epithelium)

      4. Negative controls: Include tissues not expected to express ORs

      5. Sensitivity limits: Consider that OR expression outside the olfactory system may be low

    • Beyond olfactory tissue:
      While OR52N1 is primarily expressed in olfactory sensory neurons, investigate potential expression in:

      1. Non-olfactory tissues where ectopic expression of ORs has been reported

      2. Sperm cells, which express odor receptors involved in chemotaxis

      3. Airway epithelium, where olfactory receptors have been detected

      4. Potential disease-relevant tissues based on genetic association studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.