Recombinant Human Olfactory receptor 52N2 (OR52N2)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Identification

Olfactory Receptor 52N2 is encoded by the OR52N2 gene in humans, also known by the synonym OR11-57 . The protein belongs to the extensive family of olfactory receptors, which constitutes the largest gene family in the human genome . OR52N2 is classified within family 52, subfamily N, as indicated by its nomenclature . The gene encodes a functional protein of 321 amino acids in length, with a complete sequence that has been well-characterized through various genomic and proteomic studies .

Olfactory Signal Transduction

OR52N2 functions as a chemical sensor within the olfactory system, initiating the biological processes that ultimately result in odor perception . The receptor interacts with specific odorant molecules in the nasal cavity, triggering a neuronal response that propagates to the brain for interpretation as a distinct smell . This interaction occurs through a selective binding process, where the structural configuration of the receptor's binding pocket accommodates specific molecular features of odorants .

Molecular Basis of Odorant Recognition

Recent research has provided significant insights into the molecular mechanisms of odorant binding by olfactory receptors of the OR52 family. Structural studies have revealed that the OR52 family possesses a distinctive odorant-binding pocket capable of accommodating carboxylic acids . The binding interaction involves specific amino acid residues within the transmembrane domains, creating a microenvironment that facilitates selective molecular recognition . The OR52 consensus structure (OR52cs) has been particularly valuable in elucidating these molecular details, serving as a representative model for the entire OR52 family .

Activation Mechanism

Upon odorant binding, OR52N2 undergoes conformational changes that activate associated G proteins, specifically the olfactory-type G protein (Golf), which is highly homologous to Gs . The activation mechanism involves movements of transmembrane helices, particularly TM6, which exhibits inward and outward movements of its extracellular and intracellular segments, respectively . This conformational change allows the receptor to interact with and activate Golf, initiating a signaling cascade that ultimately leads to neuronal depolarization and signal transmission to the brain .

Expression Systems and Methods

Recombinant production of human OR52N2 typically utilizes bacterial expression systems, with Escherichia coli being a common host organism . The production process involves molecular cloning of the OR52N2 gene into appropriate expression vectors, followed by transformation into the host organism and induction of protein expression . While expression of functional GPCRs can be challenging due to their hydrophobic transmembrane domains, optimization of expression conditions and the use of fusion tags have facilitated successful production of recombinant OR52N2 .

Available Recombinant Forms

Commercial recombinant OR52N2 proteins are available for research applications, typically featuring affinity tags to facilitate purification and detection. For example, His-tagged full-length human OR52N2 protein (321 amino acids) expressed in E. coli is available for research purposes . The table below summarizes the specifications of a commercially available recombinant OR52N2 protein:

Catalog #Product nameSource (Host)SpeciesTagProtein Length
RFL44HFRecombinant Full Length Human Olfactory Receptor 52N2(OR52N2) ProteinE.coliHumanHisFull Length (1-321)

Functional Characterization

Recombinant OR52N2 is valuable for functional studies investigating odorant binding specificity and receptor activation mechanisms . Molecular dynamics simulations and signaling assays using recombinant receptors have provided detailed information about the dynamics of odorant-receptor interactions and the subsequent signaling events . These functional studies complement structural investigations, offering a comprehensive understanding of how structural features translate to functional properties.

Protein-RNA Interactions

Interestingly, OR52N2 has been predicted to interact with various RNA molecules, suggesting potential functions beyond its canonical role in olfaction . Computational predictions using tools such as catRAPID have identified several RNA transcripts that potentially interact with OR52N2, with prediction scores indicating relatively strong interactions . The table below presents selected RNA transcripts predicted to interact with OR52N2:

Transcript SymbolEnsembl Transcript IDLengthPrediction ScorePrediction z-Score
TCF15-201ENST000002460801555 nt31.612.65
FBLL1-201ENST000003383331519 nt31.392.62
SEPT3-204ENST000004060291866 nt31.062.56
AL356512.1-201ENST000006074531739 nt30.982.55
HES6-203ENST000004091601600 nt30.952.54

These predicted interactions suggest potential regulatory roles for OR52N2 beyond olfactory signaling, perhaps involving post-transcriptional regulation or other RNA-mediated processes .

Molecular Dynamics and Simulations

Advanced computational approaches, including molecular dynamics simulations, have complemented experimental studies on olfactory receptors . These simulations provide detailed information about the dynamic behavior of receptors in different states, elucidating the molecular mechanisms of odorant binding and receptor activation . Such computational studies offer valuable predictions that can guide experimental investigations and provide mechanistic insights at atomic resolution.

Potential Biological Roles Beyond Olfaction

Emerging evidence suggests that olfactory receptors, including OR52N2, may have functions beyond their canonical role in olfaction . Recent research indicates that prostaglandins (PGs), important sex pheromones, play vital roles in regulating reproductive behaviors by mediating nerve and endocrine responses . This suggests potential involvement of olfactory receptors in reproductive physiology and behavior, opening new avenues for research on the non-olfactory functions of these receptors .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is established during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR52N2; Olfactory receptor 52N2; Olfactory receptor OR11-57
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-321
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR52N2
Target Protein Sequence
MSGDNSSSLTPGFFILNGVPGLEATHIWISLPFCFMYIIAVVGNCGLICLISHEEALHRP MYYFLALLSFTDVTLCTTMVPNMLCIFWFNLKEIDFNACLAQMFFVHMLTGMESGVLMLM ALDRYVAICYPLRYATILTNPVIAKAGLATFLRNVMLIIPFTLLTKRLPYCRGNFIPHTY CDHMSVAKVSCGNFKVNAIYGLMVALLIGVFDICCISVSYTMILQAVMSLSSADARHKAF STCTSHMCSIVITYVAAFFTFFTHRFVGHNIPNHIHIIVANLYLLLPPTMNPIVYGVKTK QIQEGVIKFLLGDKVSFTYDK
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15228

KEGG: hsa:390077

STRING: 9606.ENSP00000322801

UniGene: Hs.553737

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the molecular structure and classification of OR52N2?

    OR52N2 (also designated as OR11-57) is a member of the olfactory receptor family, which belongs to the G-protein-coupled receptor (GPCR) superfamily. Like other olfactory receptors, OR52N2 possesses the canonical seven-transmembrane domain (7TM) structure characteristic of GPCRs, with three extracellular loops (ECLs) and three intracellular loops (ICLs) .

    The protein is encoded by a single coding-exon gene located in the human genome and is part of the Class II (tetrapod-specific) receptor subfamily. As with other olfactory receptors, OR52N2 mediates the initial step in the olfactory signal transduction pathway by interacting with odorant molecules and triggering neuronal responses that ultimately lead to smell perception .

    Methodologically, structural predictions of OR52N2 can be performed using AlphaFold2 or comparable tools, combined with molecular dynamics simulations to evaluate potential conformational states, as has been done for other olfactory receptors in the field .

  • How should experimental designs be structured for initial OR52N2 characterization studies?

    When designing experiments for initial OR52N2 characterization, researchers should follow these methodological steps:

    a) Expression system selection: Heterologous expression systems such as HEK293 cells are recommended for initial characterization, as they have proven effective for other olfactory receptors .

    b) Experimental design approach: Implement a factorial design of experiments (DOE) to systematically investigate multiple variables simultaneously . This enables efficient exploration of factors affecting OR52N2 expression and function.

    FactorLow LevelHigh Level
    Temperature30°C37°C
    Induction time24h48h
    Expression enhancerAbsentPresent
    Detergent typeType AType B

    c) Control implementation: Include positive controls (well-characterized ORs like OR51E2) and negative controls (mock-transfected cells) .

    d) Validation approach: Employ multiple complementary techniques (e.g., Western blotting, immunofluorescence, and functional assays) to confirm successful expression and proper localization .

    e) Data analysis strategy: Use statistical methods suitable for factorial designs, such as ANOVA, to identify significant factors and potential interactions .

  • What are the recommended approaches for establishing functional assays for OR52N2?

    Establishing robust functional assays for OR52N2 requires careful consideration of the following methodological aspects:

    a) Signaling cascade measurement: Since olfactory receptors couple to Gαolf (a Gαs-like G protein), cAMP accumulation assays using BRET (Bioluminescence Resonance Energy Transfer) or FRET (Fluorescence Resonance Energy Transfer) reporters are recommended as primary readouts .

    b) Calcium mobilization: Secondary messengers can be monitored using calcium-sensitive dyes in imaging-based assays or plate reader formats .

    c) Receptor activation monitoring: Changes in receptor conformation upon ligand binding can be assessed using techniques such as:

    • BRET-based conformational sensors

    • Fluorescent ligand binding assays (if available)

    • Radiolabeled ligand binding assays (for high-sensitivity detection)

    d) Downstream signaling verification: Assess pathway-specific responses using reporter gene assays (e.g., CRE-luciferase for cAMP pathway) .

    e) Data normalization strategy: Normalize responses to positive controls to account for day-to-day variations and enable comparison across experiments.

  • What strategies should be employed for optimizing recombinant OR52N2 expression?

    Optimizing recombinant OR52N2 expression is challenging due to the typically low expression levels of olfactory receptors. Based on successful approaches with other ORs, researchers should consider:

    a) N-terminal modification: The N-terminal domain plays a crucial role in surface expression, as demonstrated for OR52cs; testing truncated or modified N-terminal variants may improve expression levels .

    b) Codon optimization: Adapt the coding sequence to the expression host's codon usage preferences while maintaining critical sequence elements.

    c) Fusion tags consideration: Evaluate various fusion partners known to enhance GPCR expression:

    • Rhodopsin N-terminal sequence

    • T4 lysozyme insertions in ICL3

    • Thermostabilized apocytochrome b562RIL (BRIL)

    d) Expression vector selection: Test multiple promoters (CMV, EF1α) and vector backbones to identify optimal expression conditions.

    e) Cell line screening: Systematically compare expression efficiency across different cell lines (HEK293, CHO, Sf9 insect cells) to identify the most suitable host .

  • What methodological approaches are needed for preliminary ligand screening with OR52N2?

    For initial ligand screening of OR52N2, researchers should implement a staged approach:

    a) In silico prediction: Utilize computational methods to predict potential ligands based on:

    • Structural similarity to known olfactory receptor ligands

    • Molecular docking into homology models

    • Pharmacophore modeling based on related receptors in the OR52 family

    b) Primary screening protocol: Implement a medium-throughput screening strategy using:

    • Focused odorant libraries (carboxylic acids, as successfully used for OR51E2 and OR52cs)

    • Dose-response testing at multiple concentrations (typically 1 nM to 100 μM)

    • EC50 determination for active compounds

    c) Confirmation strategy: Validate hits using orthogonal assays:

    • Different readout technologies

    • Receptor specificity controls (testing on related and unrelated ORs)

    • Structural analogs to establish structure-activity relationships

    d) Data analysis approach: Employ robust statistical methods to distinguish true positives from false positives, including:

    • Z-factor calculation for assay quality assessment

    • Appropriate normalization to controls

    • Multiple testing correction for large-scale screens

Advanced Research Questions

  • How can molecular dynamics simulations be optimized for OR52N2 binding pocket characterization?

    Advanced molecular dynamics (MD) simulations for OR52N2 require sophisticated computational approaches:

    a) System preparation protocol: Generate a reliable OR52N2 structural model through:

    • AlphaFold2 structure prediction

    • Refinement using available structural data from related ORs (e.g., OR51E2)

    • Proper membrane embedding in a lipid bilayer that mimics the olfactory neuron membrane environment

    b) Simulation parameters optimization:

    • Multiple microsecond-scale simulations (minimum 1 μs each, as performed for OR52cs)

    • Appropriate force fields (CHARMM36m, Amber ff14SB) for membrane proteins

    • Explicit solvent models with physiological ion concentrations

    c) Binding pocket analysis techniques:

    • Pocket volume calculations throughout the simulation trajectory

    • Identification of key residues through interaction frequency analysis

    • Water molecule dynamics within the binding pocket

    • Comparison with known binding pockets in the OR51/52 families

    d) Advanced sampling approaches:

    • Umbrella sampling for free energy profiles

    • Metadynamics for binding/unbinding energy barriers

    • Replica exchange simulations for enhanced conformational sampling

    e) Validation strategy: Compare computational predictions with site-directed mutagenesis experiments targeting predicted key residues.

  • What specialized techniques are required for structural determination of OR52N2?

    Structural determination of olfactory receptors presents significant challenges. For OR52N2, researchers should consider:

    a) Cryo-EM approach optimization:

    • Protein engineering strategies to enhance stability (e.g., thermostabilizing mutations)

    • Antibody fragment (Fab) co-crystallization to stabilize specific conformations

    • Nanobody selection for structure stabilization

    • Detergent screening to identify optimal micelle properties

    b) Sample preparation refinements:

    • Expression in insect cells or mammalian cells for proper post-translational modifications

    • Two-step affinity purification to achieve high homogeneity

    • Size exclusion chromatography to remove aggregates

    • Lipid nanodisc reconstitution for native-like environment

    c) Data collection strategy:

    • High-end microscopes with energy filters and K3 direct electron detectors

    • Collection of large datasets (>10,000 micrographs)

    • Motion correction and CTF estimation optimization

    • Particle picking using reference-free approaches

    d) Structural analysis techniques:

    • Systematic comparison with available OR structures (OR51E2, OR52cs)

    • Identification of conserved and variable regions

    • Binding pocket characterization

    • Conformational state classification

  • What strategies can overcome the challenges in deorphanizing OR52N2?

    Deorphanizing OR52N2 (identifying its natural ligands) requires a multifaceted approach:

    a) Phylogenetic analysis strategy:

    • Comprehensive comparison with deorphanized ORs in the OR52 family

    • Identification of conserved residues in the binding pocket

    • Correlation between sequence similarity and ligand preference patterns

    b) Targeted screening approach:

    • Focus on carboxylic acids with varying carbon chain lengths (as successful for OR51E2 and OR52cs)

    • Test compounds with structural similarity to ligands of phylogenetically related receptors

    • Screen compounds present in human body odors and food components

    c) Advanced functional evaluation methods:

    • Establish concentration-response relationships for candidate ligands

    • Determine EC50 values and efficacy parameters

    • Assess receptor specificity through parallel testing on related ORs

    d) Structure-guided mutation analysis:

    • Site-directed mutagenesis of predicted binding pocket residues

    • Systematic alteration of binding pocket volume (as demonstrated for OR51E2)

    • Evaluation of receptor activation profiles for each mutant

    Table: Comparative approaches for olfactory receptor deorphanization

    ApproachAdvantagesLimitationsApplication to OR52N2
    Traditional screeningUnbiased discoveryResource-intensiveTest focused libraries based on OR52 family ligands
    Phylogenetic analysisLeverages existing knowledgeLimited by available dataCompare with OR51E2 and other OR52 family members
    Structure-based virtual screeningComputationally efficientDepends on model qualityUse homology models based on OR51E2 structure
    Reverse pharmacologyIdentifies physiological relevanceComplex tissue preparationsTest candidate ligands in native olfactory neurons
  • How can researchers establish structure-activity relationships for potential OR52N2 ligands?

    Establishing structure-activity relationships (SAR) for OR52N2 requires systematic investigation:

    a) Compound library design strategy:

    • Generate focused libraries with systematic structural variations

    • Include analogs with varying:

      • Carbon chain lengths (as critical for OR51E2 and OR52cs)

      • Functional groups (hydroxyl, carboxyl, carbonyl)

      • Stereochemistry and branching patterns

    b) High-resolution dose-response analysis:

    • Test compounds at 8-12 concentrations spanning at least 4 log units

    • Determine full pharmacological parameters (EC50, Emax, Hill coefficient)

    • Analyze activation kinetics where possible

    c) Computational chemistry integration:

    • Calculate physicochemical properties (logP, TPSA, molecular volume)

    • Perform 3D-QSAR modeling

    • Identify pharmacophore features critical for receptor activation

    d) Binding mode analysis techniques:

    • Molecular docking of active and inactive analogs

    • MD simulations to assess stability of predicted binding modes

    • Comparison with binding modes established for OR51E2 and other OR52 family members

    e) Experimental validation approach:

    • Design and test compounds predicted to have specific activities

    • Validate computational models through iterative refinement

    • Map binding site through mutagenesis of residues predicted to interact with ligands

  • What experimental design considerations are essential for investigating OR52N2 signal transduction mechanisms?

    Investigating OR52N2 signal transduction requires careful experimental design:

    a) G protein coupling specificity determination:

    • BRET-based G protein activation assays with multiple Gα subtypes

    • Comparison of coupling efficiency to Gαolf versus other Gα proteins

    • Assessment of concentration-dependent activation profiles

    b) Signal transduction pathway mapping:

    • Adenylyl cyclase activation measurement

    • Calcium mobilization dynamics analysis

    • ERK1/2 phosphorylation kinetics

    • Receptor internalization and trafficking studies

    c) Allosteric modulation investigation:

    • Screen for compounds that modulate receptor response without direct activation

    • Characterize positive and negative allosteric modulators

    • Determine effects on ligand potency and efficacy

    d) Cross-talk analysis with other signaling pathways:

    • Effect of receptor activation on parallel signaling pathways

    • Influence of cellular context on signaling outcomes

    • Integration with other sensory signaling mechanisms

    e) Advanced experimental controls:

    • Use of pathway-specific inhibitors to confirm signal origin

    • CRISPR-Cas9 knockout of specific signaling components

    • Reconstitution experiments in defined cellular backgrounds

    f) Temporal resolution analysis:

    • Real-time monitoring of signaling events using biosensors

    • Determination of activation and deactivation kinetics

    • Assessment of signal persistence and adaptation mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.