Recombinant Human Olfactory receptor 56A1 (OR56A1)

Shipped with Ice Packs
In Stock

Description

Recombinant Production

Recombinant OR56A1 is synthesized using heterologous expression systems to ensure high purity and yield. Key production details include:

ParameterDetails
Expression HostE. coli or yeast (e.g., Pichia pastoris) .
TagsN-terminal His tag, FLAG, or rho1D4 epitope tags for purification .
PurificationAffinity chromatography (anti-FLAG/His tag) + size-exclusion chromatography .
Yield~1.6 mg (monomer) and ~1.1 mg (dimer) per 60 T175 flasks .
Purity>85–90% (SDS-PAGE verified) .

Ligand Binding

  • Affinity: Binds odorants like dihydrojasmone in the micromolar range (KdμK_d \approx \muM) .

  • Assays: Ligand binding quantified via intrinsic tryptophan fluorescence .

Research Applications

  • Structural Studies: X-ray crystallography and NMR due to high purity .

  • Ligand Screening: Fluorescence-based assays to identify novel odorants .

  • Antibody Development: Anti-C-terminal antibodies (e.g., OAAB10482) for Western blotting .

Challenges and Future Directions

  • Solubility: Requires detergents (e.g., DDM) for stabilization .

  • Functional Studies: Limited data on specific odorant partners for OR56A1 compared to other olfactory receptors .

  • Therapeutic Potential: GPCR-targeted drug discovery could benefit from OR56A1 structural insights .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR56A1; Olfactory receptor 56A1; Olfactory receptor OR11-75
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR56A1
Target Protein Sequence
MIQPMASPSNSSTVPVSEFLLICFPNFQSWQHWLSLPLSLLFLLAMGANTTLLITIQLEA SLHQPLYYLLSLLSLLDIVLCLTVIPKVLAIFWYDLRSISFPACFLQMFIMNSFLPMESC TFMVMAYDRYVAICHPLRYPSIITNQFVAKASVFIVVRNALLTAPIPILTSLLHYCGENV IENCICANLSVSRLSCDNFTLNRIYQFVAGWTLLGSDLFLIFLSYTFILRAVLRFKAEGA AVKALSTCGSHFILILFFSTILLVVVLTNVARKKVPMDILILLNVLHHLIPPALNPIVYG VRTKEIKQGIQKLLQRGR
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 14781

KEGG: hsa:120796

STRING: 9606.ENSP00000321246

UniGene: Hs.553543

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR56A1 and what is its role in human physiology?

OR56A1 (Olfactory Receptor, Family 56, Subfamily A, Member 1) is a member of the olfactory receptor family that plays a crucial role in detecting odorant molecules in the surrounding environment. These receptors belong to class A G-protein-coupled receptors (GPCRs) and constitute the largest transmembrane protein family in the human genome. Olfactory receptors like OR56A1 initiate neuronal responses that trigger the perception of smell when they interact with specific odorant molecules. The protein structure includes a characteristic 7-transmembrane domain shared with many neurotransmitter and hormone receptors, which is responsible for the recognition and G protein-mediated transduction of odorant signals .

The nomenclature for OR56A1 includes alternative names such as "Olfactory receptor OR11-75." The full-length human OR56A1 protein consists of 318 amino acids . Recent research has shown that olfactory receptors may have functions beyond olfaction, with expression patterns observed in non-nasal tissues, suggesting potential roles in other physiological processes.

What is the genomic structure and conservation of OR56A1 across species?

OR56A1 is encoded by a single coding-exon gene, which is characteristic of the olfactory receptor family. In humans, the OR56A1 gene is identified with gene ID 120796, and its mRNA reference sequence is NM_001001917.2 . The protein reference sequence is NP_001001917.2 with UniProt ID Q8NGH5 .

Comparative genomic analysis has identified OR56A1 orthologs in various mammalian species, including cow (gene ID 512316) . The mouse and human olfactory receptor gene families have been extensively compared, revealing important evolutionary differences. While the mouse has approximately 1,500 OR genes (with only about 20% being pseudogenes), humans have a significantly smaller functional repertoire. This suggests that humans rely less on olfaction than mice, resulting in lower selective pressure to maintain functional OR genes .

OR genes typically cluster in genomic locations. Mouse ORs are found in 46 clusters, while the human pattern is more dispersed. Despite this difference, orthologous clusters can be found at syntenic locations across species, indicating that most OR gene clusters predate primate-rodent divergence. Local duplications have been a major force shaping this gene family, often obscuring one-to-one orthologous relationships between species .

What are the recommended methods for expressing recombinant OR56A1?

Recombinant expression of OR56A1 presents several challenges common to membrane proteins, particularly GPCRs. Based on successful protocols for similar olfactory receptors, the following methodological approach is recommended:

  • Expression System Selection: Both bacterial (E. coli) and mammalian cell systems have been used successfully for OR56A1 expression, with each offering distinct advantages:

    • E. coli: Higher yield but may require optimization for proper folding

    • Mammalian cells: Better for functional studies due to appropriate post-translational modifications

  • Construct Design: For optimal expression and purification, incorporate epitope tags:

    • N-terminal tags: FLAG tag enables immunoaffinity purification

    • C-terminal tags: His-tag facilitates purification via metal affinity chromatography

    • The full amino acid sequence for human OR56A1 is: MIQPMASPSNSSTVPVSEFLLICFPNFQSWQHWLSLPLSLLFLLAMGANTTLLITIQLEASLHQPLYYLLSLLSLLDIVLCLTVIPKVLAIFWYDLRSISFPACFLQMFIMNSFLPMESCTFMVMAYDRYVAICHPLRYPSIITNQFVAKASVFIVVRNALLTAPIPILTSLLHYCGENVIENCICANLSVSRLSCDNFTLNRIYQFVAGWTLLGSDLFLIFLSYTFILRAVLRFKAEGAAVKALSTCGSHFILILFFSTILLVVVLTNVARKKVPMDILILLNVLHHLIPPALNPIVYGVRTKEIKQGIQKLLQRGR

  • Expression Induction and Optimization: For tetracycline-inducible systems like those used for other ORs, the following parameters should be optimized:

    • Induction time and temperature

    • Cell density at induction

    • Concentration of inducing agent

A particularly effective approach demonstrated for similar olfactory receptors involves using a stable tetracycline-inducible HEK293S cell line, with the receptor engineered to contain both C-terminal rho1D4 epitope tags and N-terminal FLAG epitope tags to facilitate purification and detection .

What are the most effective purification strategies for recombinant OR56A1?

Purification of recombinant OR56A1 requires specific techniques to maintain protein stability and functionality. Based on protocols developed for similar olfactory receptors, a multi-step purification process is recommended:

  • Initial Solubilization: Carefully select detergents that effectively solubilize the membrane-embedded receptor without denaturing it. Common detergents used for ORs include:

    • n-dodecyl-β-D-maltoside (DDM)

    • n-octyl-β-D-glucopyranoside (OG)

    • Digitonin

  • Affinity Purification:

    • For His-tagged OR56A1: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins

    • For FLAG-tagged constructs: Anti-FLAG immunoaffinity purification using monoclonal antibodies

  • Size Exclusion Chromatography (SEC):

    • Critical for separating monomeric and dimeric forms of the receptor

    • Can be coupled with multi-angle light scattering (SEC-MALS) to determine oligomeric state

  • Purity Assessment: SDS-PAGE analysis should confirm purity >85-90%

  • Structural Analysis: Circular dichroism can be used to confirm proper folding of the purified receptor

Using this approach for similar olfactory receptors, researchers have successfully purified both monomeric (~1.6 mg) and dimeric (~1.1 mg) forms from sixty T175 flasks .

How can researchers assess the functional activity of recombinant OR56A1?

Functional characterization of recombinant OR56A1 requires specialized assays that measure the receptor's signaling capabilities. The following methodological approaches are recommended:

  • cAMP Signaling Assays:

    • Real-time cAMP assays can be employed to assess the functional activity of OR56A1 in heterologous cell systems

    • This approach measures G protein-coupled signaling downstream of receptor activation

  • Ligand Binding Assays:

    • Intrinsic tryptophan fluorescence assays can quantify ligand binding to detergent-solubilized OR56A1

    • For similar olfactory receptors, this method has revealed binding affinities in the micromolar range

  • Competition ELISA:

    • ELISA-based competition assays can be used with a detection range of 50-1000 pg/mL

    • The minimum detection limit for such assays is typically around 50 pg/mL

  • Analytical Characterization:

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) analysis can identify the presence of both monomeric and dimeric forms of OR56A1

These functional analyses are critical for understanding the receptor's ligand specificity and signaling properties, which can vary significantly among olfactory receptors despite their structural similarities.

What experimental considerations are important when studying OR56A1 protein-protein interactions?

When investigating OR56A1 protein-protein interactions, researchers should consider several methodological approaches and experimental factors:

  • Dimerization Analysis:

    • OR56A1 has been shown to exist in both monomeric and dimeric forms

    • Techniques such as SEC-MALS, FRET, or crosslinking studies can help characterize these oligomeric states

  • G-Protein Coupling:

    • As a GPCR, OR56A1 interacts with G-proteins to transduce signals

    • Altered G-protein transduction protein gene expression has been observed in certain conditions, potentially affecting OR56A1 signaling

  • Co-Immunoprecipitation (Co-IP):

    • Using available antibodies for OR56A1 (such as rabbit polyclonal antibodies), researchers can pull down OR56A1 and identify interacting proteins

    • Applications include ELISA, Western Blot (WB), and Immunofluorescence (IF)

  • Consideration of Experimental Systems:

    • Cell type selection is critical as expression systems can influence post-translational modifications and interaction partners

    • Sample types validated for OR56A1 analysis include cell culture supernatant, plasma, serum, and tissue homogenate

Understanding these protein-protein interactions is essential for elucidating the broader signaling network of OR56A1 and its potential roles beyond olfaction.

What are the optimal storage conditions for recombinant OR56A1 proteins?

Proper storage of recombinant OR56A1 proteins is critical for maintaining their structural integrity and functional activity. Based on manufacturer recommendations for OR56A1 products, the following guidelines should be followed:

  • Long-term Storage:

    • Store lyophilized form at -20°C/-80°C for up to 12 months

    • Store liquid form at -20°C/-80°C for up to 6 months

    • Aliquot the protein to avoid repeated freeze-thaw cycles

  • Working Stock:

    • Store working aliquots at 4°C for up to one week

    • Repeated freezing and thawing is not recommended as it can lead to protein denaturation

  • Reconstitution Protocol:

    • Briefly centrifuge vials prior to opening to bring contents to the bottom

    • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol (final concentration) is recommended for long-term storage

    • The default final concentration of glycerol is typically 50%

  • Buffer Considerations:

    • Tris/PBS-based buffer with 6% Trehalose, pH 8.0 has been successfully used

    • For detergent-solubilized receptor, maintain appropriate detergent concentration above its critical micelle concentration (CMC)

Adherence to these storage guidelines will help ensure the stability and activity of recombinant OR56A1 for experimental use.

What quality control measures should be implemented when working with OR56A1 antibodies?

When working with OR56A1 antibodies for research applications, implementing rigorous quality control measures is essential to ensure reliable and reproducible results:

  • Antibody Validation:

    • Verify specificity using multiple applications (ELISA, WB, IF, ICC)

    • Confirm reactivity with the target species (human, mouse, rat)

    • Use known positive and negative controls to establish specificity

  • Performance Characteristics:

    • Determine optimal working dilutions for each application:

      • ICC/IF: 1:200 - 1:1000

      • ELISA: 1:5000

    • Verify the observed molecular weight matches the calculated molecular weight (calculated: ~36 kDa; observed: ~72 kDa for glycosylated form)

  • Storage and Handling:

    • Store antibodies at -20°C for long-term storage

    • For frequent use, store at 4°C for up to one month

    • Avoid repeated freeze-thaw cycles

    • Most OR56A1 antibodies are supplied in PBS containing 50% glycerol, 0.5% BSA, and 0.02% sodium azide

  • Cross-Reactivity Testing:

    • Test for potential cross-reactivity with other olfactory receptors, particularly those within the same subfamily

    • Blocking peptides can be used to confirm specificity of the antibody binding

Implementing these quality control measures will help ensure the reliability and reproducibility of results when using OR56A1 antibodies in research applications.

How is OR56A1 implicated in non-olfactory physiological processes?

While OR56A1 is primarily known as an olfactory receptor, emerging research suggests potential roles in non-olfactory tissues and physiological processes:

  • Reproductive Biology:

    • Gene expression studies have identified altered OR56A1 expression in patients with non-obstructive azoospermia (NOA)

    • Specifically, OR56A1 appears to be upregulated in testicular tissues of NOA patients compared to normal controls, alongside other genes such as GOLGA8IP, OR2AT4, PHKA1, A2M, SEMA3G, LRRC17, APP, and others

    • This suggests potential roles in spermatogenesis or testicular function

  • Gene Expression in Disease States:

    • Whole transcriptome analysis has identified OR56A1 as potentially regulated by non-coding RNAs in certain disease conditions

    • Recent studies have employed various platforms (including microarray and RNA-seq) to analyze differential gene expression in normal versus pathological states

  • Research Approaches:

    • Single-cell RNA sequencing (scRNA-seq) has been valuable in identifying cell type-specific expression patterns of OR56A1

    • Spatial transcriptomics provides insights into tissue architecture context that might be missed by other single-cell analyses

The implication of OR56A1 in these non-olfactory processes opens new avenues for research, particularly in reproductive biology and disease pathogenesis.

What are the latest techniques for studying OR56A1 structure-function relationships?

Advanced techniques for elucidating the structure-function relationships of OR56A1 involve a combination of molecular, computational, and biophysical approaches:

These approaches collectively contribute to our understanding of how OR56A1's structure relates to its odorant recognition and signaling functions.

What are the optimal conditions for OR56A1 ELISA assays?

When performing ELISA assays for OR56A1 detection and quantification, researchers should consider several methodological parameters to ensure optimal results:

  • ELISA Type and Parameters:

    • Competition ELISA is commonly used for OR56A1 detection

    • Detection range: 50-1000 pg/mL

    • Minimum detection limit: 50 pg/mL

    • Sensitivity: 1.0 pg/mL

  • Sample Preparation:

    • Compatible sample types include:

      • Cell culture supernatant

      • Plasma

      • Serum

      • Tissue homogenate

    • Proper sample dilution is crucial for accurate quantification within the linear range

  • Protocol Considerations:

    • Required materials include:

      • Precision pipettors and disposable tips

      • Absorbance microplate reader capable of measuring at 450 nm

      • Centrifuge capable of 3000 x g

      • Incubator (37°C)

    • Standard curve preparation using provided standards (A through F)

    • Enzyme conjugate, substrate solutions, and stop solution should be prepared according to manufacturer's instructions

  • Quality Control:

    • Include duplicate or triplicate measurements

    • Incorporate positive and negative controls

    • Evaluate intra- and inter-assay coefficients of variation (CV)

Adherence to these methodological guidelines will help ensure reliable and reproducible quantification of OR56A1 in research samples.

How can single-cell analysis techniques be applied to study OR56A1 expression patterns?

Single-cell analysis offers unprecedented resolution for studying OR56A1 expression patterns across different cell types and tissues. The following methodological approaches are particularly valuable:

  • Single-Cell RNA Sequencing (scRNA-seq):

    • Enables identification of cell populations expressing OR56A1

    • Reveals previously unknown cell types that may express this receptor

    • Can uncover cell type-specific co-expression patterns with other genes

  • Single-Cell Assay for Transposase-Accessible Chromatin Sequencing (scATAC-seq):

    • Examines open chromatin at the individual cell level

    • Helps identify transcription factors that may regulate OR56A1 expression

    • Provides insights into the epigenetic regulation of OR56A1 in different cell types

  • Spatial Transcriptomics:

    • Integrates spatial information with gene expression data

    • Addresses limitations of other single-cell techniques by preserving tissue architecture context

    • Particularly valuable for studying OR56A1 expression in complex tissues like olfactory epithelium or testis

  • Methodological Considerations:

    • Sample preparation protocols must be optimized to maintain cell viability and RNA integrity

    • Computational analysis requires specialized bioinformatics pipelines for data normalization and interpretation

    • Integration of multiple single-cell modalities (multi-omics) provides the most comprehensive view

These advanced single-cell approaches have been instrumental in revealing unexpected expression patterns of olfactory receptors in non-olfactory tissues, opening new avenues for understanding OR56A1 function beyond its canonical role in olfaction.

How does OR56A1 compare to other olfactory receptors in terms of evolutionary conservation and function?

Comparative analysis of OR56A1 with other olfactory receptors provides important insights into its evolutionary history and functional specialization:

  • Evolutionary Patterns:

    • The olfactory receptor gene family is the largest in the mammalian genome

    • Comprehensive comparative analysis between human and mouse OR genes reveals different evolutionary processes shaped these gene families

    • While humans have a relatively high percentage of OR pseudogenes, mice maintain a larger functional OR repertoire (approximately three times larger than humans)

  • Genomic Organization:

    • OR56A1 belongs to clusters of OR genes found at specific genomic locations

    • Mouse ORs are clustered in 46 genomic locations, whereas human ORs show a more dispersed pattern

    • Most OR gene clusters predate primate-rodent divergence, with orthologous clusters found at syntenic locations across species

  • Functional Divergence:

    • OR family includes members capable of responding to a large set of odorants and members activated by only a small number of related odorants

    • Local duplications have been the major force shaping this gene family, often obscuring one-to-one orthologous relationships

    • Interchromosomal duplications have occurred more frequently in humans than in mice

  • Receptor-Ligand Interactions:

    • Understanding the molecular mechanisms governing receptor-ligand interactions remains a key research focus

    • Purified olfactory receptors like OR56A1, when properly folded, can be used to study ligand binding properties in vitro

These comparative analyses help elucidate the selective pressures that have shaped OR56A1 evolution and its specialized functions within the olfactory system.

What are the emerging applications of OR56A1 research in understanding human diseases?

Research on OR56A1 is beginning to reveal potential connections to various human diseases and conditions, opening new avenues for biomedical applications:

  • Male Infertility:

    • Altered expression of OR56A1 has been observed in patients with non-obstructive azoospermia (NOA)

    • Gene expression studies have identified OR56A1 among several genes upregulated in testicular tissues of NOA patients

    • This suggests potential roles in spermatogenesis or testicular function that could be targeted for diagnostic or therapeutic purposes

  • Disease-Associated Gene Networks:

    • Whole transcriptome analysis has identified OR56A1 within networks of genes regulated by non-coding RNAs in certain pathological conditions

    • Understanding these regulatory networks may provide insights into disease mechanisms

  • Biomarker Development:

    • Differential expression of OR56A1 in specific tissues or conditions might serve as a potential biomarker

    • Research datasets from microarray and RNA-seq studies (e.g., GSE45885, GSE9210, GSE108886, GSE145467, GSE216907, GSE235324) provide valuable resources for identifying such patterns

  • Methodological Advances Supporting Clinical Applications:

    • Development of specific antibodies and ELISA kits for OR56A1 detection facilitates clinical research

    • Single-cell analysis techniques offer unprecedented resolution for studying OR56A1 expression in patient samples

These emerging applications highlight the potential translational value of basic research on OR56A1, extending well beyond its canonical role in olfaction to possible implications in human disease processes and reproductive health.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.