Recombinant Human Olfactory receptor 56B4 (OR56B4)

What is the basic structure of Human Olfactory Receptor 56B4?

Human Olfactory Receptor 56B4 (OR56B4) is a full-length protein consisting of 319 amino acids (1-319aa). It belongs to the class A G-protein-coupled receptors (GPCRs) family, specifically within the olfactory receptor subfamily. The receptor contains a seven-transmembrane domain structure characteristic of GPCRs. The complete amino acid sequence is: MDTSTSVTYDSSLQISQFILMGLPGIHEWQHWLSLPLTLLYLLALGANLLIIITIQHETVLHEPMYHLLGILAVVDIGLATTIMPKILAIFWFDAKAISLPMCFAQIYAIHCFFCIESGIFLCMAVDRYIAICRPLQYPSIVTKAFVFKATGFIMLRNGLLTIPVPILAAQRHYCSRNEIEHCLCSNLGVISLACDDITVNKFYQLMLAWVLVGSDMALVFSSYAVILHSVLRLNSAEAMSKALSTCSSHLILILFHTGIIVLSVTHLAEKKIPLIPVFLNVLHNVIPPALNPLACALRMHKLRLGFQRLLGLGQDVSK .

What alternative names and identifiers are associated with OR56B4?

The receptor is formally known as Olfactory Receptor 56B4 but can also be referenced as:

• Olfactory receptor OR11-67 (alternative name)

• UniProt accession number: Q8NH76

• Part of the CLASS A OLFACTORY RECEPTORS subfamily

• Gene name: OR56B4

How does OR56B4 compare to other human olfactory receptors?

OR56B4 is one of approximately 400 intact human odorant receptors. Olfactory receptors constitute the largest transmembrane protein family in the human genome. Based on current research, only about 10% of human olfactory receptors have published ligands. Like other ORs, OR56B4 likely functions within the combinatorial coding scheme of olfaction, where distinct patterns of receptor activation encode different odor perceptions. The receptor's specific ligand profile and response characteristics are still being investigated in comparison to other receptors in this extensive family .

What are the optimal conditions for recombinant expression of OR56B4?

For recombinant expression of OR56B4, the optimal approach based on current protocols involves:

• Expression System: E. coli has been successfully used for recombinant OR56B4 production with an N-terminal His tag . For functional studies, mammalian expression systems such as HEK293S cells with tetracycline-inducible promoters are recommended, as demonstrated with other olfactory receptors .

• Expression Vector Modifications: Incorporating epitope tags enhances purification efficiency. For OR56B4, an N-terminal His tag has been effectively used. Based on similar OR studies, dual tagging with C-terminal rho1D4 and N-terminal FLAG epitopes can facilitate both purification and detection in functional assays .

• Expression Optimization:

  • Temperature: Typically 30-37°C for E. coli systems

  • Induction: IPTG at 0.5-1mM for bacterial systems; tetracycline at 1μg/ml for inducible mammalian systems

  • Duration: 4-24 hours post-induction depending on the expression system

The lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added for long-term storage stability .

What purification strategies yield highest purity and activity for OR56B4?

Based on similar olfactory receptor purification protocols, a multi-step purification strategy is recommended for OR56B4:

• Initial Extraction: Solubilize membrane fractions containing the receptor using appropriate detergents (DDM, CHAPS, or MNG-3 at 1-2% concentration).

• Affinity Purification: Utilize the N-terminal His tag with immobilized metal affinity chromatography (IMAC) using Ni-NTA resin. For dual-tagged constructs, anti-FLAG immunoaffinity purification has proven effective for other ORs .

• Size Exclusion Chromatography: Further purify using gel filtration to separate monomeric and oligomeric forms. This step is critical as olfactory receptors can exist in both monomeric and dimeric states, as observed with other receptors like hOR1A1 .

• Yield Expectations: From sixty T175 flasks of mammalian cells, yields of approximately 1.6 mg of monomeric and 1.1 mg of dimeric receptor forms can be expected, based on comparable OR purification data .

• Quality Control: Verify proper folding using circular dichroism analysis and functional activity using ligand binding assays .

How can researchers validate the structural integrity of purified OR56B4?

Several complementary techniques can be employed to validate the structural integrity of purified OR56B4:

• Circular Dichroism (CD) Spectroscopy: Provides information about secondary structure elements and proper folding of the receptor. The CD spectrum should display characteristics consistent with alpha-helical transmembrane proteins .

• Size Exclusion Chromatography-Multi-Angle Light Scattering (SEC-MALS): This technique can determine the oligomeric state of the purified receptor, distinguishing between monomeric and dimeric forms. For other ORs, this approach has successfully identified both forms in purified preparations .

• Intrinsic Tryptophan Fluorescence Assay: Measures changes in fluorescence upon ligand binding, confirming that the receptor maintains its native conformation capable of ligand interaction. This method has been successfully applied to measure binding affinities in the micromolar range for other olfactory receptors .

• SDS-PAGE and Western Blotting: Verifies protein purity, molecular weight, and recognition by tag-specific antibodies. The expected molecular weight for OR56B4 is approximately 35-40 kDa .

• Thermal Stability Assays: Techniques such as differential scanning fluorimetry can assess protein stability and the impact of different buffer conditions or ligands on protein folding.

What cellular assays are most effective for measuring OR56B4 activation?

Several cellular assays have proven effective for measuring olfactory receptor activation and can be applied to OR56B4:

• Luciferase-Based cAMP Assays: This real-time assay system measures receptor activation through cAMP-dependent luciferase reporter gene expression. The protocol involves:

  • Co-transfection of HEK293 cells with the OR56B4 construct, RTP1S (5 ng/well), pRL-SV40 (5 ng/well), CRE-luciferase (10 ng/well), and M3 (2.5 ng/well)

  • Stimulation with potential odorants 24 hours post-transfection

  • Luminescence measurement 4 hours after odor stimulation

  • Normalization with Renilla luciferase activity to control for transfection efficiency

• Calcium Imaging: Measures intracellular calcium flux upon receptor activation using fluorescent calcium indicators like Fluo-4 or Fura-2.

• BRET/FRET-Based Assays: Monitors conformational changes or protein-protein interactions during receptor activation using resonance energy transfer techniques.

• Impedance-Based Assays: Measures whole-cell responses to receptor activation in real-time without labels.

For optimal results, the inclusion of receptor transport proteins (RTPs) and other accessory factors is recommended to enhance surface expression and functionality of the receptor in heterologous systems .

How can researchers design effective screening protocols to identify OR56B4 ligands?

Based on established protocols for olfactory receptor ligand identification, an effective screening approach for OR56B4 would include:

• Primary Screen Design:

  • Express OR56B4 in a heterologous system (e.g., Hana3A cells)

  • Include positive controls (broadly-tuned ORs like OR2W1) and standardization controls

  • Screen a diverse panel of odorants at 100 μM concentration

  • Include no-odor controls to establish baseline responses

  • Normalize responses using standard receptors (e.g., Olfr544 response to nonanedioic acid)

• Secondary Screen Design:

  • Select top 5% of odorant/receptor pairs from primary screen

  • Test each potential ligand at multiple concentrations (1, 10, and 100 μM)

  • Perform all tests in triplicate

  • Include appropriate vector-only controls

• Dose-Response Analysis:

  • Construct dose-response curves using concentrations ranging from 10 nM to 10 mM

  • Fit data to sigmoidal curves

  • Confirm agonist activity when:
    a) 95% confidence intervals of top and bottom parameters do not overlap
    b) Standard deviation of fitted log EC50 is less than 1 log unit
    c) Extra sums-of-squares test confirms significant activation compared to vector-only control

• Cross-Validation:

  • Validate hits using orthogonal assays (calcium imaging, BRET)

  • Confirm specificity by testing structurally related compounds

  • Examine structure-activity relationships of confirmed ligands

This systematic approach has successfully identified ligands for other olfactory receptors and can be applied to OR56B4 characterization .

What are the key considerations for buffer composition when studying OR56B4 function?

Buffer composition significantly impacts the stability and function of olfactory receptors like OR56B4. Key considerations include:

• Storage Buffer Composition:

  • Tris/PBS-based buffer systems at pH 8.0 are recommended

  • Addition of 6% Trehalose acts as a stabilizing agent

  • For long-term storage, 5-50% glycerol (final concentration) should be added

  • Aliquoting is necessary to avoid repeated freeze-thaw cycles which can compromise receptor integrity

• Reconstitution Conditions:

  • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Brief centrifugation prior to opening vials ensures all contents are at the bottom

• Functional Assay Considerations:

  • For cellular assays, CD293 media has been successfully used for odor dilution

  • DMSO is commonly used to prepare 1M odorant stocks, but final DMSO concentration should be kept below 0.1% to avoid cellular toxicity

  • Odorant preparation requires careful handling to prevent evaporation or degradation

• Detergent Selection for Solubilized Receptor:

  • Mild non-ionic detergents (DDM, MNG) at concentrations just above their critical micelle concentration

  • Cholesterol hemisuccinate (CHS) addition (0.01-0.1%) can enhance stability

  • Detergent must maintain receptor in a functional state capable of ligand binding

• Ligand Binding Assay Buffers:

  • Buffers containing physiological ion concentrations (150 mM NaCl)

  • Presence of divalent cations (1-2 mM CaCl₂ and MgCl₂)

  • pH maintained at 7.2-7.4

  • Reducing agents (DTT or TCEP at 0.5-1 mM) to prevent disulfide formation

Optimizing these buffer conditions is critical for maintaining OR56B4 in its native conformation capable of ligand interaction.

How does OR56B4 oligomerization affect its function and ligand binding properties?

OR56B4 oligomerization likely plays a significant role in its function, based on observations from other olfactory receptors:

• Oligomeric States:
  Size exclusion chromatography-multi-angle light scattering (SEC-MALS) analysis of purified olfactory receptors has demonstrated the presence of both monomeric and dimeric forms. This pattern is likely applicable to OR56B4 as well. The ratio between these forms may be influenced by detergent conditions, lipid environment, and protein concentration .

• Functional Implications:
  Dimerization of GPCRs, including olfactory receptors, can modulate:

  • Signal transduction efficiency through altered G-protein coupling

  • Ligand binding cooperativity (positive or negative)

  • Receptor trafficking and surface expression

  • Receptor desensitization and internalization kinetics

• Experimental Approaches:
  To investigate the impact of OR56B4 oligomerization on function:

  • Separate monomeric and dimeric forms using SEC

  • Compare ligand binding properties using intrinsic tryptophan fluorescence assays

  • Employ resonance energy transfer techniques (FRET/BRET) to study oligomerization dynamics in live cells

  • Create mutations at potential dimer interfaces to disrupt oligomerization

  • Analyze the effects of lipids and cholesterol on oligomeric state distributions

• Technical Considerations:

  • Detergent choice significantly impacts observed oligomeric states

  • Native nanodiscs or styrene maleic acid lipid particles (SMALPs) may better preserve physiologically relevant oligomeric distributions

  • Crosslinking approaches can stabilize transient interactions for analysis

Understanding the relationship between OR56B4 oligomerization and function may provide insights into the molecular mechanisms of olfactory signal transduction and receptor activation.

What strategies can overcome the challenges of OR56B4 structural determination?

• Protein Engineering Approaches:

  • Thermostabilizing mutations identified through alanine scanning or directed evolution

  • Fusion with crystallization chaperones (T4 lysozyme, BRIL, rubredoxin) between transmembrane helices 5 and 6

  • N- and C-terminal truncations to remove disordered regions

  • Introduction of disulfide bridges to stabilize specific conformations

  • Creation of antibodies or nanobodies against conformational epitopes

• Expression Optimization:

  • Screening multiple expression systems (bacterial, yeast, insect, mammalian)

  • Codon optimization for the chosen expression host

  • Use of specialized strains (e.g., C41/C43 for toxic membrane proteins)

  • Incorporation of N-terminal signal sequences to enhance membrane targeting

• Purification Considerations:

  • Systematic detergent screening to identify optimal extraction and purification conditions

  • Lipid supplementation during purification to maintain native-like environment

  • Use of nanodiscs or amphipols for detergent-free structural studies

  • Monodispersity assessment using FSEC (fluorescence-detection size-exclusion chromatography)

• Structural Determination Methods:

  • X-ray crystallography with lipidic cubic phase (LCP) crystallization

  • Single-particle cryo-electron microscopy for larger complexes

  • Solid-state NMR for specific structural elements

  • Integrative structural biology combining multiple low-resolution techniques

• Computational Approaches:

  • Homology modeling based on related GPCR structures

  • Molecular dynamics simulations to study conformational dynamics

  • Deep learning methods (AlphaFold2) for structure prediction

The successful purification of other olfactory receptors like hOR1A1 in milligram quantities suggests that with appropriate optimization, structural studies of OR56B4 are feasible .

How can OR56B4 research contribute to understanding the molecular basis of olfaction?

Research on OR56B4 can provide significant insights into several aspects of olfactory perception:

• Receptor-Ligand Interaction Mechanisms:

  • Identifying the ligand binding profile of OR56B4 contributes to understanding the combinatorial code of olfaction

  • Structure-activity relationship studies with various odorants can reveal key molecular determinants of receptor activation

  • Mutagenesis of binding pocket residues can identify critical amino acids involved in odorant recognition

• Evolutionary Perspectives:

  • Comparative analysis of OR56B4 with orthologous receptors across species provides insights into olfactory adaptation

  • Investigation of polymorphisms within human populations can reveal the genetic basis for individual differences in odor perception

  • Correlation between receptor sequence conservation and ligand specificity patterns

• Contribution to the Olfactory Receptor Database:

  • Only approximately 10% of human olfactory receptors have published ligands

  • Adding OR56B4 ligand information expands this knowledge base

  • Datasets from screening will allow researchers to interrogate the combinatorial nature of olfactory coding

• Translational Applications:

  • Development of biosensors for specific odorant detection

  • Understanding the molecular basis of olfactory disorders

  • Design of novel odorants with predicted perceptual qualities

• Integration with Systems-Level Olfactory Research:

  • How OR56B4 activation patterns integrate with other receptors in the olfactory system

  • Contribution to perceptual qualities of complex odors

  • Signal integration mechanisms at the olfactory bulb level

This research contributes to filling significant gaps in our understanding of how the human olfactory system discriminates among thousands of odorous compounds through the combinatorial activation of hundreds of receptors .

What are common challenges in OR56B4 expression and how can they be addressed?

Olfactory receptors present several expression challenges that researchers working with OR56B4 should anticipate:

• Low Surface Expression:

  • Challenge: Poor trafficking to plasma membrane in heterologous systems

  • Solution: Co-expression with receptor transport proteins (RTP1S, 5 ng/well) and accessory factors (M3, 2.5 ng/well) significantly enhances surface expression

  • Alternative: Use specialized cell lines like Hana3A cells that are optimized for OR expression

• Protein Misfolding:

  • Challenge: Aggregation and retention in endoplasmic reticulum

  • Solution: Lower expression temperatures (28-30°C), addition of chemical chaperones (4-phenylbutyrate, DMSO at low concentrations), and optimized signal sequences

• Low Functional Response:

  • Challenge: Minimal signal in reporter assays

  • Solution: Optimize the signal detection system using CRE-luciferase (10 ng/well) with standardization controls (pRL-SV40, 5 ng/well)

  • Alternative: Amplify signal using chimeric G proteins or modified downstream signaling components

• Expression Toxicity:

  • Challenge: Cell death during overexpression

  • Solution: Use inducible expression systems (tetracycline-inducible) to control expression timing and level

  • Alternative: Screen lower inducer concentrations to find optimal expression window

• Post-Expression Handling:

  • Challenge: Loss of activity during purification

  • Solution: Maintain protein in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 and add 5-50% glycerol for long-term storage

  • Alternative: Aliquot protein solutions to avoid repeated freeze-thaw cycles

Systematic optimization of these parameters will significantly improve OR56B4 expression outcomes in both cellular assays and purification protocols.

How should researchers interpret conflicting ligand binding data for OR56B4?

When faced with conflicting ligand binding data for OR56B4, researchers should consider several factors that might contribute to discrepancies:

• Expression System Variables:

  • Different cell lines (HEK293, Hana3A, SF9) may provide varying post-translational modifications

  • Accessory protein levels (RTPs, REEP) influence surface expression and coupling efficiency

  • Compare expression levels across systems using quantitative western blotting or flow cytometry

• Assay-Dependent Factors:

  • Different readout systems (cAMP, calcium, β-arrestin) have varying sensitivities and temporal resolutions

  • Luciferase-based assays may differ in detection windows (4 hours post-stimulation is standard)

  • Control for assay-specific artifacts by using multiple orthogonal methods

• Ligand Preparation Considerations:

  • Odorant purity and storage conditions affect activity

  • Volatile compounds may evaporate during experiments

  • Stock solutions in DMSO should be prepared fresh and kept at appropriate concentrations

• Data Analysis Approach:

  • Standardize data normalization methods (using control receptors like Olfr544 with nonanedioic acid)

  • Apply rigorous statistical criteria to define positive responses:

    • Non-overlapping 95% confidence intervals between top and bottom parameters

    • Standard deviation of fitted log EC50 less than 1 log unit

    • Statistical confirmation using extra sums-of-squares test

• Receptor Polymorphisms:

  • Check the exact sequence used, as polymorphic variants may show different ligand specificities

  • Compare against reference sequence (UniProt: Q8NH76) to identify potential variations

When publishing results, researchers should thoroughly document methodological details and clearly state the criteria used to define positive responses, enabling better comparison across studies.

What advanced analytical techniques can provide deeper insights into OR56B4 dynamics?

Several cutting-edge analytical techniques can reveal deeper insights into OR56B4 dynamics and function:

• Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Maps conformational changes upon ligand binding

  • Identifies flexible regions and binding-induced protection patterns

  • Requires approximately 50-100 μg of purified receptor per condition

  • Can work with detergent-solubilized receptors or membrane preparations

• Single-Molecule FRET (smFRET):

  • Observes conformational dynamics of individual receptor molecules

  • Reveals intermediate states and transition kinetics missed in ensemble measurements

  • Requires strategic placement of fluorophores at conformationally sensitive positions

  • Can track receptor dynamics in real-time during activation

• NMR Spectroscopy:

  • ¹⁹F-NMR with strategically incorporated fluorinated amino acids can probe site-specific conformational changes

  • Methyl-TROSY approaches provide insights into dynamics of large membrane proteins

  • Requires isotopic labeling (¹³C, ¹⁵N, ²H) for detailed studies

  • Can work with detergent-solubilized or nanodisc-reconstituted receptors

• Molecular Dynamics Simulations:

  • All-atom simulations reveal detailed receptor dynamics in membrane environments

  • Coarse-grained approaches allow longer timescale events to be observed

  • Enhanced sampling methods (metadynamics, umbrella sampling) can characterize energy landscapes

  • Integration with experimental data strengthens predictive power

• Native Mass Spectrometry:

  • Determines oligomeric states and ligand binding stoichiometry

  • Preserves non-covalent interactions during analysis

  • Compatible with various membrane-mimetic systems (nanodiscs, amphipols)

  • Requires specialized instrumentation and sample preparation

• Microfluidic Diffusional Sizing:

  • Measures hydrodynamic radius changes upon ligand binding

  • Works with low protein concentrations (μg range)

  • Label-free detection of binding events

  • Rapid analysis suitable for screening multiple conditions

These advanced techniques, when combined with traditional functional assays, provide a comprehensive understanding of OR56B4 structure-function relationships and activation mechanisms.

Comparative Properties of Recombinant OR56B4 Protein

Recommended Transfection Components for Functional Assays

Criteria for Confirming Receptor-Ligand Interactions

What are the most promising future research directions for OR56B4?

The study of OR56B4 offers several promising research directions that could significantly advance our understanding of olfactory perception:

• Structural Biology: The successful purification strategies developed for other olfactory receptors pave the way for structural determination of OR56B4. Cryo-EM approaches, especially with the advances in obtaining structures of challenging membrane proteins, represent a particularly promising avenue. These structures would provide unprecedented insights into ligand binding mechanisms and receptor activation .

• Deorphanization: Identifying the natural ligands of OR56B4 through systematic screening approaches and structure-based virtual screening would expand the limited knowledge base of receptor-ligand pairs in the olfactory system. Currently, only about 10% of human olfactory receptors have published ligands .

• Integration into the Olfactory Code: Understanding how OR56B4 activation patterns combine with other receptors to encode odor perception is a critical area for investigation. High-throughput screening methods coupled with machine learning approaches could accelerate this research .

• Synthetic Biology Applications: Engineered cells expressing OR56B4 could serve as biosensors for specific environmental chemicals or biomarkers, with applications in environmental monitoring, food safety, and medical diagnostics.

• Comparative Genomics: Analysis of OR56B4 orthologs across species could reveal evolutionary adaptations in olfactory perception and provide insights into human-specific olfactory capabilities.

These research directions would contribute valuable data to our understanding of olfactory perception at both molecular and systems levels, with potential applications extending beyond basic science to biotechnology and medicine.

How might OR56B4 findings translate to broader applications in olfactory research?

The knowledge gained from OR56B4 research has potential to translate into several broader applications:

• Improved In Vitro Olfactory Models: Protocols developed for OR56B4 expression, purification, and functional characterization can be applied to other olfactory receptors, accelerating the development of comprehensive in vitro olfactory systems. These systems could reduce reliance on animal models for fragrance and flavor testing .

• Drug Discovery Platforms: Methodologies used to study OR56B4 can inform approaches for other GPCRs, which represent targets for approximately 30-40% of all modern medicines. The heterologous expression systems and screening protocols have broad applicability .

• Digital Olfaction Technology: Understanding the molecular recognition properties of OR56B4 contributes to efforts in developing electronic noses and digital olfaction technologies that mimic human smell perception.

• Personalized Olfactory Medicine: Knowledge of OR56B4 function could help explain individual variations in odor perception, potentially enabling personalized approaches to conditions involving altered smell sensation.

• Evolutionary Biology Insights: The study of OR56B4 in the context of the extensive olfactory receptor family provides a model system for understanding gene family expansion, contraction, and functional diversification, with implications for broader evolutionary biology questions.