Recombinant Human Olfactory receptor 5AC1 (OR5AC1)

Shipped with Ice Packs
In Stock

Description

Research Context and Challenges

OR5AC1 was tested in a 2022 study using LNCaP prostate carcinoma cells to address challenges in OR deorphanization . Key findings include:

Key Findings from LNCaP Cell Studies

ParameterObservationRelevance
Basal ActivityHigh constitutive activity complicates ligand detection
Functional AssayIdentified novel ligands for ORs unresponsive in HEK293 cells
OR5AC1 InclusionTested among 34 ORs with unknown ligands; no ligands reported for OR5AC1

This study highlights the limitations of heterologous expression systems and the need for specialized cell lines for OR characterization.

Comparative Analysis with Related Receptors

While OR5AC1-specific data are sparse, insights can be inferred from structurally similar receptors like OR5AL1 and OR51E2.

ReceptorLigandsExpression SystemKey FindingsSource
OR5AL1UnknownCell-free (recombinant)Full-length protein (1–328 aa)
OR51E2Propionate (short-chain FA)Cryo-EM structural analysisBinding pocket size determines specificity
OR5AC1UndeterminedLNCaP cellsNo ligands identified in studies

Diagnostic and Therapeutic Tools

  • Olfactory Biosensors: OR5AC1 could be integrated into cell-array sensors (e.g., human OR sensor systems) for odor reconstitution .

  • Cancer Research: ORs like OR5AC1 are expressed in prostate cancer cells, suggesting roles in chemotaxis or proliferation regulation .

Research Gaps

  1. Ligand Discovery: Only ~25% of human ORs have known ligands; OR5AC1 remains uncharacterized .

  2. Structural Elucidation: Cryo-EM studies (e.g., OR51E2 ) could clarify OR5AC1’s binding mechanism.

  3. Functional Validation: High-throughput screening in specialized cell lines (e.g., LNCaP) is critical .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize development according to your specifications.
Synonyms
OR5AC1; OR5AC1P; Olfactory receptor 5AC1; Olfactory receptor OR3-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR5AC1
Target Protein Sequence
MAEENKILVTHFVLTGLTDHPGLQAPLFLVFLVIYLITLVGNLGLMALIWKDPHLHTPIY LFLGSLAFADACTSSSVTSKMLINFLSKNHMLSMAKCATQFYFFGSNATTECFLLVVMAY DRYVAICNPLLYPVVMSNSLCTQFIGISYFIGFLHSAIHVGLLFRLTFCRSNIIHYFYCE ILQLFKISCTNPTVNILLIFIFSAFIQVFTFMTLIVSYSYILSAILKKKSEKGRSKAFST CSAHLLSVSLFYGTLFFMYVSSRSGSAADQAKMYSLFYTIIIPLLNPFIYSLRNKEVIDA LRRIMKK
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15047

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR5AC1 and what is its fundamental structure?

OR5AC1 (Olfactory Receptor 5AC1) is a G-protein coupled receptor involved in olfactory signal transduction. Also known as OR5AC1P or Olfactory receptor OR3-2, this receptor consists of 307 amino acids and functions as an odorant receptor. The protein belongs to the G-protein coupled receptor 1 family and contains the characteristic seven-transmembrane domain structure typical of this receptor class .

Functionally, OR5AC1 plays a role in the detection and discrimination of odor molecules by binding to specific odorants and initiating signaling cascades that ultimately lead to odor perception. The receptor is part of the largest gene family in the human genome, with olfactory receptors exhibiting highly specialized ligand recognition properties.

What expression systems are optimal for producing functional recombinant OR5AC1?

For functional studies, researchers should consider multiple expression systems based on their specific experimental objectives:

Expression SystemAdvantagesChallengesBest Used For
E. coliHigh yield, cost-effective, rapid expressionLacks post-translational modifications, inclusion body formationStructural studies, antibody production
Insect cells (Sf9, Sf21)Better folding of membrane proteins, post-translational modificationsMore complex, higher costFunctional studies, crystallography
Mammalian cells (HEK293, CHO)Native-like post-translational modifications, proper foldingHighest cost, lower yield, time-consumingFunctional assays, interaction studies
Cell-free systemsRapid, avoids toxicity issuesLower yield, higher costRapid screening, difficult-to-express proteins

The choice of expression system should align with research objectives and must be carefully documented in experimental methods to ensure reproducibility across studies.

What are the optimal storage conditions for maintaining OR5AC1 stability?

Proper storage of recombinant OR5AC1 is critical for maintaining protein stability and functionality. Based on the product information, researchers should implement the following storage protocol :

  • Store the lyophilized protein at -20°C/-80°C upon receipt

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended 50%) for long-term storage

  • Create small aliquots to minimize freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • For long-term storage, flash freeze aliquots and store at -80°C

Researchers should verify protein stability through techniques such as SDS-PAGE before key experiments to ensure that storage conditions have not compromised protein integrity. Repeated freeze-thaw cycles significantly reduce protein activity and should be strictly avoided through proper aliquoting procedures .

What quality control measures should be implemented when working with recombinant OR5AC1?

Quality control is essential for ensuring experimental reproducibility when working with recombinant OR5AC1. Researchers should implement a systematic verification protocol:

  • Purity Assessment: Confirm protein purity is ≥85% as determined by SDS-PAGE

  • Identity Verification: Validate protein identity through:

    • Western blotting with anti-His antibodies (for His-tagged protein)

    • Mass spectrometry to confirm molecular weight and sequence

    • N-terminal sequencing for additional confirmation

  • Functional Integrity: Assess receptor functionality through:

    • Ligand binding assays with known odorants

    • Structural analysis via circular dichroism

    • Secondary structure verification

Implementing these quality control measures before experimental use ensures that observed results are attributable to the protein of interest rather than contaminants or degraded material, enhancing the reliability of research findings.

What experimental designs are most suitable for studying OR5AC1 binding affinities?

When investigating OR5AC1 binding affinities, researchers should implement robust experimental designs that account for the unique challenges of olfactory receptor studies. Based on experimental design principles, a comprehensive approach should include :

  • Variable Definition and Control:

    • Independent variables: Potential ligand compounds, ligand concentrations, buffer conditions

    • Dependent variables: Binding affinity measurements (Kd, Ki values), receptor activation metrics

    • Control variables: Temperature, pH, protein batch, incubation time

  • Randomization and Replication:

    • Randomize the order of testing different ligands to avoid systematic bias

    • Perform biological replicates (different protein preparations) and technical replicates

    • Include positive controls (known ligands) and negative controls (non-binding compounds)

  • Methodological Approaches:

Binding Assay TypeMethodologyAdvantagesLimitations
Radioligand BindingDisplacement of radiolabeled ligandQuantitative, direct measurementRequires radioactive materials, limited by availability of known ligands
Fluorescence-basedFRET, fluorescent ligand displacementReal-time measurement, no radioactivityPotential interference from fluorophores
Surface Plasmon ResonanceLabel-free detection of bindingReal-time kinetics, no labels requiredRequires immobilization which may affect protein function
Microscale ThermophoresisThermal mobility changes upon bindingLow protein consumption, solution-basedSpecialized equipment needed

A factorial experimental design testing multiple potential odorants at various concentrations enables comprehensive mapping of the receptor's ligand specificity profile while controlling for confounding variables .

How can researchers assess the functional activity of recombinant OR5AC1?

Assessing the functional activity of recombinant OR5AC1 requires experimental designs that detect receptor activation upon ligand binding. This involves:

  • Heterologous Expression Systems:
    Establish cell lines expressing:

    • OR5AC1 receptor

    • Appropriate G-protein subunits (typically Gαolf for olfactory receptors)

    • Necessary accessory proteins (RTP1S, Ric-8B) to enhance surface expression

  • Functional Readout Methods:

Assay TypeMethodologyMeasurementsConsiderations
Calcium MobilizationCalcium-sensitive dyes (Fluo-4, Fura-2)Fluorescence changes upon receptor activationFast response, good for screening
cAMP AssaysELISA, FRET-based sensorsQuantification of cAMP productionReflects canonical OR signaling through Gαolf
BRETEnergy transfer between luciferase and fluorescent proteinReal-time monitoring of protein interactionsAllows measurement of multiple signaling events
ElectrophysiologyPatch-clamp recordingDirect measurement of cellular electrical responsesHigh temporal resolution but technically demanding
  • Experimental Design Considerations :

    • Include dose-response curves (10^-9 to 10^-3 M range for most odorants)

    • Test multiple time points to capture signaling kinetics

    • Include positive controls (known olfactory receptor agonists)

    • Negative controls (vehicle, non-responsive cells)

    • Use randomized plate layouts to control for positional effects

This methodological framework allows systematic evaluation of OR5AC1 functional properties across different experimental conditions.

What are the key considerations when designing experiments to compare wild-type and mutant OR5AC1?

  • Mutation Selection Strategy:

    • Rational design based on sequence alignment with related receptors

    • Structural predictions from computational modeling

    • Evolutionarily conserved residues

    • Site-directed mutagenesis targeting predicted binding pocket residues

  • Expression Level Normalization:

    • Quantify receptor expression through Western blotting with N-terminal tags (His, FLAG)

    • Surface expression measurements (flow cytometry, ELISA)

    • Adjust experimental readouts to account for expression differences

  • Experimental Design Framework :

Experimental ComponentDescriptionPurpose
Factorial DesignTest multiple mutants with multiple ligandsIdentify specific residue-ligand interactions
Control GroupsEmpty vector, non-functional mutant (negative); known functional OR (positive)Establish baseline and maximum responses
Replication StrategyBiological replicates (≥3 independent transfections); technical replicates (≥3 per condition)Control for transfection variability and measurement error
RandomizationRandomize plate positions, measurement orderMinimize systematic bias
BlindingBlind analysis of results when possiblePrevent observer bias
  • Functional Characterization:

    • Compare parameters between wild-type and mutants:

      • Basal activity (constitutive activity)

      • Ligand binding affinity (EC50/IC50)

      • Efficacy (maximum response)

      • Signal transduction kinetics

This comprehensive approach ensures that differences observed between wild-type and mutant OR5AC1 can be attributed to specific structural features.

How can confounding variables be controlled in OR5AC1 ligand binding studies?

Sources of Confounding in OR5AC1 Studies:

  • Protein-Related Variables:

    • Receptor expression levels

    • Post-translational modifications

    • Protein folding and membrane insertion

    • Oligomerization state

  • Experimental Condition Variables:

    • Temperature fluctuations

    • pH variations

    • Buffer composition differences

    • Presence of detergents or solubilizing agents

Control Strategies:

Confounding VariableControl MethodImplementation
Receptor Expression VariationNormalization to expression levelWestern blot quantification; ELISA for surface expression
Post-translational ModificationsConsistent expression systemUse same cell line and passage number across experiments
Protein Folding HeterogeneityQuality control measuresSize-exclusion chromatography; circular dichroism analysis
Temperature EffectsTemperature-controlled environmentWater-jacketed chambers; temperature monitoring throughout experiment
pH VariationsBuffered solutionsHigh-capacity buffers; pH monitoring before and after experiments
Compound Solubility IssuesConsistent solvent conditionsStandardized solvent percentage; solubility verification

By systematically identifying and controlling potential confounding variables through proper experimental design, researchers can increase the internal validity of OR5AC1 binding studies and improve reproducibility .

What approaches are recommended for troubleshooting inconsistent results with recombinant OR5AC1?

When faced with inconsistent results in experiments using recombinant OR5AC1, implement this systematic troubleshooting approach:

  • Protein Quality Assessment:

    • Verify protein purity via SDS-PAGE (≥85% purity expected)

    • Confirm identity through mass spectrometry or western blotting

    • Assess aggregation state using size-exclusion chromatography

    • Check for proteolytic degradation with fresh aliquots

  • Storage and Handling Evaluation:

ParameterPotential IssueVerification MethodSolution
Storage TemperatureProtein denaturation from improper storageActivity comparison of different storage conditionsMaintain strict -80°C storage; avoid frequent freeze-thaw
Freeze-Thaw CyclesLoss of activity with repeated cyclesActivity testing after controlled freeze-thaw seriesPrepare single-use aliquots
Buffer CompatibilityPrecipitation or inactivation in experimental buffersVisual inspection; activity testing in different buffersOptimize buffer composition; add stabilizers
Reconstitution MethodImproper refolding after lyophilizationCircular dichroism to assess secondary structureFollow manufacturer's protocol; optimize reconstitution conditions
  • Experimental Controls Implementation :

    • Include internal standards in each experiment

    • Run parallel positive controls with known activity

    • Implement negative controls to establish baseline

    • Use technical replicates to assess measurement precision

  • Statistical Analysis and Data Interpretation:

    • Implement robust statistical methods resistant to outliers

    • Calculate coefficients of variation to quantify inconsistency

    • Apply appropriate data transformations when necessary

    • Use ANOVA with post-hoc tests for multiple comparisons

By systematically addressing these potential sources of variability, researchers can improve the reproducibility and reliability of their experiments with recombinant OR5AC1.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.