Recombinant Human Olfactory receptor 5AC2 (OR5AC2)

Shipped with Ice Packs
In Stock

Description

Overview of OR5AC2

OR5AC2 is a class II olfactory receptor localized to human chromosome 3 . It shares the seven-transmembrane domain structure characteristic of GPCRs and is involved in recognizing odorant molecules, initiating neuronal responses that contribute to the sense of smell . The recombinant version is produced for research purposes to study its ligand-binding properties, structural dynamics, and role in olfactory signaling.

Recombinant Production

Recombinant OR5AC2 is synthesized using heterologous expression systems to ensure high purity and functionality. Key production details include:

ParameterSpecification
Expression SystemEscherichia coli (in vitro)
TagN-terminal 10xHis-tag for purification
Sequence CoverageFull-length protein (1-309 amino acids)
UniProt IDQ9NZP5
Molecular Weight~35-40 kDa (estimated)

The protein is typically stored at -20°C or -80°C to maintain stability, with a shelf life of 6–12 months depending on storage conditions .

Applications in Research

Recombinant OR5AC2 is utilized in:

  • Ligand Screening: Identifying odorants or synthetic compounds that activate or inhibit the receptor .

  • Structural Studies: Investigating GPCR dynamics via homology modeling .

  • Diagnostic Assays: Quantifying OR5AC2 in biological samples using ELISA kits (detection range: 0.156–10 ng/ml) .

Research Findings

While specific ligands for OR5AC2 remain uncharacterized, studies on olfactory receptors broadly reveal:

  • Combinatorial Coding: Multiple receptors contribute to detecting a single odorant .

  • Species-Specific Variations: Humans have ~400 functional olfactory receptors, fewer than mice (~1,400), reflecting evolutionary adaptations .

  • Disease Links: Olfactory receptor dysfunction is implicated in neurodegenerative disorders like Alzheimer’s .

Future Directions

Current challenges include deorphanizing OR5AC2 (identifying its ligands) and resolving its 3D structure. Advances in cryo-EM and high-throughput screening may accelerate these efforts .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Specify your desired tag type for preferential development.
Synonyms
OR5AC2; Olfactory receptor 5AC2; HSA1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR5AC2
Target Protein Sequence
MDISEGNKTLVTEFVLTGLTDRPWLHVLFFVVFLVVYLITMVGNLGLIVLIWNDPHLHMP MYLFLGGLAFSDACTSTSITPRMLVNFLDKTAMISLAECITQFYFFASSATTECFLLVMM AYDRYVAICNPLLYPVMMSNKLSAQLLSISYVIGFLHPLVHVSLLLRLTFCRFNIIHYFY CEILQLFKISCNGPSINALMIFIFGAFIQIPTLMTIIISYTRVLFDILKKKSEKGRSKAF STCGAHLLSVSLYYGTLIFMYVRPASGLAEDQDKVYSLFYTIIIPLLNPFIYSLRNKKVM HALRRVIRK
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15431

KEGG: hsa:81050

STRING: 9606.ENSP00000351466

UniGene: Hs.554715

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR5AC2 and what is its genomic context?

OR5AC2 (olfactory receptor family 5 subfamily AC member 2) is a protein-coding gene located on chromosome 3 in humans. It encodes an olfactory receptor protein involved in the sense of smell, triggering neuronal responses that lead to odor perception. OR5AC2 belongs to the G-protein-coupled receptor 1 family, the largest gene superfamily in the human genome . This receptor, also known as HSA1, functions as a chemoreceptor expressed in the cell membranes of olfactory receptor neurons . Like other olfactory receptors, OR5AC2 is part of the class A rhodopsin-like family of G protein-coupled receptors (GPCRs) that form the largest multigene family in vertebrates, with humans possessing approximately 400 functional olfactory receptor genes .

How do researchers distinguish OR5AC2 from other olfactory receptors in experimental systems?

Distinguishing OR5AC2 from other olfactory receptors requires multiple complementary approaches:

  • Genetic identification: Use of specific PCR primers that target unique sequences in the OR5AC2 gene

  • Epitope tagging: Addition of unique tags (e.g., FLAG, HA) to the N-terminus or C-terminus of the receptor for antibody detection

  • Fluorescent protein fusion: Creating OR5AC2-GFP fusion proteins for visualization and tracking, similar to methods used for other olfactory receptors

  • Antibody-based detection: Using OR5AC2-specific antibodies for immunohistochemistry or Western blotting

  • Functional deorphanization: Characterizing unique response profiles to odorant panels

When using these methods, it is essential to include appropriate controls with other olfactory receptors to confirm specificity, as cross-reactivity is common due to sequence similarities within the olfactory receptor family .

What expression systems are most effective for producing functional recombinant OR5AC2?

Several expression systems have been employed for olfactory receptors, with varying success rates for producing functional proteins:

Expression SystemAdvantagesDisadvantagesYieldFunctional Status
HEK293T cellsMammalian post-translational modifications, Compatible with GPCR foldingModerate expression levels10^5-10^6 receptors/cellOften functional
Hana3A cellsEnhanced surface trafficking via RTP1-4 and REEP1 co-expressionSpecialized cell line10^6-10^7 receptors/cellHighly functional
Sf9 insect cellsHigh expression levelsDifferent lipid composition10^7-10^8 receptors/cellVariable functionality
Cell-free systemsRapid production, Avoids cell toxicityLimited post-translational modificationsVariableRequires refolding

For OR5AC2 specifically, mammalian expression systems using Hana3A cells (which express accessory factors like RTP1, RTP2, and olfactory G-proteins) typically produce the most functional receptor protein . When using any heterologous expression system, co-expression with chaperone proteins such as receptor-transporting proteins (RTPs) significantly improves surface expression and functionality of the receptor .

What strategies can overcome the challenges in expressing functional OR5AC2?

Olfactory receptors, including OR5AC2, are notoriously difficult to express due to poor trafficking to the plasma membrane. Researchers can employ several strategies to overcome these challenges:

  • Co-expression with accessory proteins: Include RTPs (Receptor Transporting Proteins), REEPs (Receptor Expression Enhancing Proteins), and Ric-8B to enhance surface expression

  • N-terminal modifications:

    • Addition of the first 20 amino acids of rhodopsin (Rho-tag)

    • Removal of N-glycosylation sites

    • Codon optimization for the expression system

  • Temperature modulation: Expression at lower temperatures (30°C instead of 37°C) can improve folding

  • Detergent selection: Use of mild detergents (DDM, LMNG, or GDN) for membrane extraction

Validation of functional expression should include both surface localization assays and functional response measurements to confirm the receptor maintains its native conformation and signaling capabilities .

What methodologies are most reliable for identifying ligands that activate OR5AC2?

Multiple complementary approaches can be used to identify and validate OR5AC2 ligands:

  • Calcium imaging assays: Cells expressing OR5AC2 are loaded with calcium-sensitive dyes (e.g., Fura-2 AM), and changes in intracellular calcium are measured upon odorant application.

  • cAMP reporter assays: Since olfactory receptors couple to Gαolf (stimulating adenylyl cyclase), cAMP production can be measured using:

    • CRE-luciferase reporters

    • FRET-based cAMP sensors (e.g., EPAC-based sensors)

    • GloSensor assays

  • Electrophysiological recordings: Patch-clamp techniques can measure channel activity downstream of OR activation.

  • Impedance measurements: Real-time cell analysis systems can detect morphological changes following receptor activation.

The M2OR database contains experimental data on OR-molecule interactions and can serve as a valuable resource for designing new ligand screening experiments or comparing results . When conducting these assays, it's crucial to include both positive controls (known GPCR ligands) and negative controls (cells without receptor expression) to validate assay performance and specificity .

How can researchers accurately determine the specificity and sensitivity of OR5AC2 responses to odorants?

Determining OR5AC2 specificity and sensitivity requires rigorous experimental design and data analysis:

  • Concentration-response relationships:

    • Test increasing concentrations of odorants (typically 10^-9 to 10^-3 M)

    • Calculate EC50 values to quantify potency

    • Determine efficacy (maximum response) for each ligand

  • Structure-activity relationships:

    • Test structurally related compounds to map the pharmacophore

    • Analyze how molecular features (functional groups, stereochemistry) affect response

  • Cross-receptor activation profiles:

    • Test the same odorants on related olfactory receptors

    • Calculate selectivity indices (ratio of EC50 values)

  • Temporal response characteristics:

    • Measure activation kinetics, adaptation, and recovery

    • Analyze response patterns to dynamic stimuli with varying onset times

  • Data normalization approaches:

    Normalization MethodAdvantagesDisadvantages
    % of maximum responseCompares relative efficacyRequires maximum stimulation
    % of standard odorantAllows cross-experiment comparisonDepends on standard stability
    Z-score transformationAccounts for baseline variabilityAbstract units
    ΔF/F for calcium imagingControls for dye loadingSensitive to baseline fluctuations

Research has shown that olfactory perceptions depend on odorant concentration, with changes in concentration potentially leading to different perceptions of hedonicity or olfactory quality . Therefore, when characterizing OR5AC2, it's essential to test multiple concentrations and carefully report both screening concentrations and EC50 values for all experimental data .

How do copy number variations (CNVs) affect OR5AC2 expression and function in human populations?

Copy number variations (CNVs) significantly impact the olfactory receptor gene family, including OR5AC2:

Research using high-resolution oligonucleotide tiling microarrays has revealed that OR genomic loci are frequently affected by CNVs, creating a mosaic of OR dosages across individuals . These variations have functional consequences:

  • Expression level differences: More gene copies typically lead to higher expression levels

  • Functional redundancy: CNVs may provide compensatory mechanisms when some receptor variants are non-functional

  • Population-specific olfactory capabilities: Different populations show distinct patterns of OR CNVs

Studies have shown that approximately 50% of OR CNVs involve more than one OR gene, with the largest CNV spanning 11 loci . Interestingly, CNVs are more frequent among OR pseudogenes than among intact genes, presumably due to both selective constraints and CNV formation biases .

For research involving OR5AC2, it's crucial to:

  • Genotype study participants for OR5AC2 CNVs

  • Account for copy number in expression analyses

  • Consider CNVs when interpreting population differences in odor perception

The enrichment of CNVs among ORs with a close human paralog or lacking a one-to-one ortholog in chimpanzee suggests ongoing evolutionary dynamics that may affect OR5AC2 function across human populations .

What bioinformatic approaches can predict OR5AC2 ligand binding sites and potential odorant interactions?

Several computational approaches can help predict OR5AC2 ligand interactions:

  • Molecular docking simulations: Virtual screening of odorant libraries

    • Identifies potential binding modes and interaction energies

    • Software options include AutoDock, DOCK, and Glide

    • Should be validated with experimental mutagenesis

  • Machine learning approaches:

    • Support Vector Machines and Random Forests trained on known OR-ligand pairs

    • Graph neural networks capturing molecular similarity

    • Integration of data from the M2OR database

  • Evolutionary analysis:

    • Identification of positively selected sites likely involved in ligand binding

    • Conservation analysis across species to identify functionally important residues

    • Comparison with related ORs that have known ligands

  • QM/MM methods: Quantum mechanics/molecular mechanics simulations to model electronic interactions in the binding site

These computational predictions should guide experimental designs, particularly site-directed mutagenesis studies to validate the predicted binding sites. The M2OR database, which contains experimental data from 42 scientific articles and information about OR-molecule interactions, is a valuable resource for training and validating these computational models .

How can OR5AC2 be employed in biosensor development for environmental or clinical applications?

OR5AC2 can be engineered into various biosensor platforms for detecting specific odorants:

  • Cell-based biosensors:

    • Engineered cells expressing OR5AC2 coupled to reporter systems

    • Advantages: Maintain native receptor environment and signal amplification

    • Limitations: Require cell culture facilities, shorter shelf life

  • Solid-state biosensors:

    • Immobilized OR5AC2 on field-effect transistors or quartz crystal microbalance devices

    • Advantages: Portable, rapid response, no cellular components needed

    • Limitations: Reduced sensitivity, receptor stability issues

  • Synthetic biology approaches:

    • Engineering yeast or bacteria to express OR5AC2 and produce visible output signals

    • Creating cell-free systems with reconstituted OR5AC2 signaling components

  • Potential applications:

    ApplicationTarget AnalytesDetection MethodSensitivity
    Food qualitySpoilage compoundsOptical/electricalppb-ppm
    EnvironmentalPollutants, toxinsElectrical/mass-basedppt-ppb
    Medical diagnosticsDisease biomarkersFluorescence/electricalVariable
    SecurityExplosives, drugsArray-based patternsppb

These biosensor applications require careful optimization of receptor stability, as maintaining the native conformation of OR5AC2 outside the cell membrane is challenging. Strategies like directed evolution to improve stability, coupling with nanomaterials, and optimization of immobilization methods can help overcome these limitations .

What role does OR5AC2 play in the broader context of olfactory coding and perception?

Understanding OR5AC2's role in olfactory coding requires considering several key principles:

By studying OR5AC2 in this broader context, researchers gain insights into how individual receptors contribute to the complex process of odor perception and discrimination .

What are the NIH guidelines and institutional requirements for conducting research with recombinant OR5AC2?

Research involving recombinant OR5AC2 must comply with the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules :

  • Definition and scope:

    • The guidelines apply to: (i) molecules constructed by joining nucleic acid molecules that can replicate in a living cell; (ii) nucleic acid molecules that are synthesized or amplified and can base pair with naturally occurring nucleic acid molecules; and (iii) molecules that result from replication of those described in (i) or (ii)

    • This includes work with recombinant OR5AC2 expression vectors and cell lines

  • Institutional oversight requirements:

    • Research must be approved by an Institutional Biosafety Committee (IBC)

    • Principal investigators must submit detailed protocols describing:

      • Vector construction

      • Expression systems

      • Containment procedures

      • Risk assessment

  • Biosafety level determination:

    Research ActivityTypical BSL LevelKey Requirements
    Plasmid constructionBSL-1Standard microbiological practices
    Mammalian cell expressionBSL-2Biological safety cabinet, limited access
    Viral vector deliveryBSL-2+Enhanced practices, dedicated equipment
  • Training requirements:

    • All personnel must be trained in biosafety procedures

    • Documentation of training must be maintained

    • Annual refresher training is typically required

Importantly, any changes to approved protocols must be submitted for review before implementation. For experiments involving the administration of recombinant OR5AC2 to research participants (human gene transfer), additional regulatory approvals are required, and no such experiment shall be initiated until IBC approval has been obtained and all applicable regulatory authorizations and approvals have been secured .

What quality control measures are essential when producing recombinant OR5AC2 for research applications?

Ensuring the quality and consistency of recombinant OR5AC2 preparations requires rigorous quality control measures:

  • Expression verification:

    • Western blot analysis with anti-OR5AC2 or anti-tag antibodies

    • Mass spectrometry confirmation of protein identity

    • qRT-PCR for mRNA expression levels

  • Purity assessment:

    • SDS-PAGE with Coomassie or silver staining (≥85% purity recommended)

    • Size-exclusion chromatography to detect aggregates

    • Endotoxin testing for mammalian applications

  • Functional validation:

    • Ligand binding assays to confirm proper folding

    • G-protein coupling assays (e.g., [35S]GTPγS binding)

    • Calcium mobilization or cAMP production in response to known agonists

    • Comparison with positive control receptors

  • Stability testing:

    • Thermal stability assays (differential scanning fluorimetry)

    • Time-course activity measurements

    • Freeze-thaw stability testing

  • Storage recommendations:

    • Store in Tris-based buffer with 50% glycerol at -20°C

    • For extended storage, conserve at -80°C

    • Avoid repeated freeze-thaw cycles

    • Prepare working aliquots and store at 4°C for up to one week

  • Batch consistency measures:

    ParameterMethodAcceptance Criteria
    Protein concentrationBCA or Bradford assayWithin 10% of specification
    ActivityDose-response to standard ligandEC50 within 3-fold of reference
    PuritySDS-PAGE densitometry≥85%
    EndotoxinLAL assay<0.1 EU/μg protein
    AggregationDLS or SEC<10% high molecular weight species

These quality control measures ensure that experimental results using recombinant OR5AC2 are reproducible and reliable. Particularly for functional studies, it's crucial to note that OR responses can show assay-dependent bias . Therefore, standardization of expression systems, assay conditions, and quality control parameters is essential for meaningful comparison of results across different studies .

How can researchers optimize experimental designs for studying OR5AC2-ligand interactions?

Optimizing experimental designs for OR5AC2-ligand interaction studies requires careful consideration of multiple factors:

  • Experimental controls:

    • Positive controls: Use well-characterized ORs with known ligands (e.g., OR1A1 with citronellal)

    • Negative controls: Mock-transfected cells and cells expressing unrelated ORs

    • Vehicle controls: Account for solvent effects (especially with DMSO or ethanol)

  • Odorant handling:

    • Prepare fresh stock solutions in appropriate solvents (typically DMSO or ethanol)

    • Use gas-tight containers to prevent odorant volatilization

    • Control for odorant degradation with analytical verification

    • Standardize delivery methods to ensure reproducible concentrations

  • Statistical design:

    • Minimum of 3-6 biological replicates

    • Technical triplicates for each biological replicate

    • Power analysis to determine appropriate sample size

    • Randomized plate layouts to minimize position effects

    • Include internal standards for plate-to-plate normalization

  • Temporal considerations:

    • Standardize post-transfection timing for assays (typically 48h)

    • Consider receptor internalization and desensitization

    • Account for potential temporal sensitivity in olfactory signaling

Research has shown that olfactory perception is dependent on odorant concentration, with changes in concentration potentially leading to different perceptions . Therefore, comprehensive concentration-response relationships are essential for accurately characterizing OR5AC2-ligand interactions .

What are the common pitfalls in OR5AC2 research and how can they be addressed?

Research with olfactory receptors, including OR5AC2, presents several challenges that require specific troubleshooting approaches:

ChallengePotential CausesTroubleshooting Strategies
Poor receptor expressionInefficient trafficking, Protein misfolding, ToxicityCo-express with RTP1S, REEP1, and Ric-8B; Use Rho-tag fusion; Lower expression temperature; Test different promoters
High background in functional assaysEndogenous receptor expression, Non-specific responsesUse receptor-null cell lines; Include mock-transfected controls; Validate with multiple assay formats
Inconsistent responsesReceptor desensitization, Variable expression levels, Compound degradationStandardize exposure times; Use inducible expression systems; Prepare fresh compounds; Verify compound stability
Non-reproducible ligand identificationAssay-dependent bias, Compound impurities, Cellular context differencesTest in multiple assay systems; Use analytical-grade compounds; Maintain consistent cell culture conditions
Difficulties in deorphanizationLimited odorant screening libraries, Narrow concentration range, Missing cofactorsExpand chemical diversity in screening; Test wide concentration ranges; Consider native nasal environment factors

Key methodological considerations to address these issues include:

  • Expression system selection: Different cell lines may show variable results. The M2OR database highlights that functional studies of ORs have relied on various bioassays, including native olfactory sensory neurons and different heterologous expression systems, and responses can show assay-dependent bias .

  • Signal-to-background optimization:

    • Use serum starvation to reduce basal activity

    • Optimize cell density for maximal signal

    • Consider signal amplification strategies (e.g., chimeric G-proteins)

  • Reproducibility measures:

    • Document detailed experimental conditions (temperature, humidity, etc.)

    • Record passage number of cells used

    • Standardize transfection efficiency measurements

    • Implement rigorous data normalization protocols

By anticipating these challenges and implementing appropriate controls and validation strategies, researchers can increase the reliability and reproducibility of their OR5AC2 studies .

What emerging technologies are likely to advance our understanding of OR5AC2 function?

Several cutting-edge technologies show promise for enhancing OR5AC2 research:

  • Cryo-EM and structural biology:

    • Recent advances in cryo-electron microscopy may enable direct visualization of OR5AC2 structure

    • Determining the 3D structure would revolutionize understanding of ligand binding mechanisms

    • Nanobody stabilization approaches could help capture different conformational states

  • Single-cell omics:

    • Single-cell RNA sequencing to map OR5AC2 expression patterns in olfactory epithelium

    • Spatial transcriptomics to understand the distribution of OR5AC2-expressing neurons

    • Integration with functional data to correlate expression with odor responses

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize OR5AC2 localization and trafficking

    • Calcium imaging with genetically encoded calcium indicators in OR5AC2-expressing neurons

    • Multi-photon imaging in intact olfactory epithelium

  • AI and computational approaches:

    • Deep learning models to predict OR5AC2-ligand interactions

    • Integration of structural, genetic, and functional data through machine learning

    • Virtual screening of millions of compounds to identify novel ligands

The adaptation of olfactory receptor abundances for efficient coding suggests that receptor distribution may be tuned to maximize information about the olfactory environment . New technologies that can track these adaptations at cellular and molecular levels will provide deeper insights into how OR5AC2 contributes to olfactory perception in different contexts and environments .

How might research on OR5AC2 contribute to broader applications in sensory biology and bioengineering?

Research on OR5AC2 has implications that extend beyond basic olfactory science:

  • Biomedical applications:

    • Development of olfactory-based diagnostic tools for diseases with olfactory signatures

    • Understanding mechanisms of anosmia and potential therapeutic approaches

    • Exploration of ectopic OR5AC2 expression in non-olfactory tissues and potential physiological roles

  • Environmental monitoring:

    • Creation of OR5AC2-based biosensors for detecting specific environmental chemicals

    • Arrays of olfactory receptors including OR5AC2 for "electronic nose" technologies

    • Remote sensing applications for hazardous environments

  • Evolutionary biology insights:

    • Comparative studies of OR5AC2 across species to understand olfactory adaptations

    • Investigation of copy number variations and their impact on olfactory perception

    • Understanding selective pressures shaping human olfactory receptor repertoires

  • Synthetic biology platforms:

    ApplicationDescriptionResearch Stage
    Olfactory cell linesEngineered cell lines expressing defined OR setsEarly development
    Biosensing devicesIntegrated OR5AC2-based detection systemsProof of concept
    Scent reproductionReverse engineering of complex scentsTheoretical
    Metabolic engineeringUsing ORs to detect metabolic productsEmerging
  • Sensory neuroscience integration:

    • Understanding multimodal sensory integration

    • Investigating the relationship between genetic variation in OR5AC2 and perceptual differences

    • Exploring the role of efficient coding principles in other sensory systems

The unique challenges and characteristics of olfactory receptors—the largest gene family in the human genome with highly individualized variation patterns—provide a model system for understanding G-protein coupled receptor biology, evolution, and function . Research on OR5AC2 contributes to this broader understanding while also opening new avenues for biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.