Recombinant Human Olfactory receptor 5AK2 (OR5AK2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to meet your needs.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its incorporation.
Synonyms
OR5AK2; Olfactory receptor 5AK2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR5AK2
Target Protein Sequence
MTLGNSTEVTEFYLLGFGAQHEFWCILFIVFLLIYVTSIMGNSGIILLINTDSRFQTLTY FFLQHLAFVDICYTSAITPKMLQSFTEEKNLMLFQGCVIQFLVYATFATSDCYLLAMMAV DPYVAICKPLHYTVIMSRTVCIRLVAGSYIMGSINASVQTGFTCSLSFCKSNSINHFFCD VPPILALSCSNVDINIMLLVVFVGSNLIFTGLVVIFSYIYIMATILKMSSSAGRKKSFST CASHLTAVTIFYGTLSYMYLQSHSNNSQENMKVAFIFYGTVIPMLNPLIYSLRNKEVKEA LKVIGKKLF
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15251

KEGG: hsa:390181

STRING: 9606.ENSP00000322784

UniGene: Hs.554520

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of human OR5AK2 and how does it compare to other olfactory receptors?

OR5AK2 belongs to the G-protein coupled receptor 1 family, sharing structural similarities with other olfactory receptors such as OR5AL1. Based on comparative analysis with other characterized olfactory receptors, OR5AK2 likely consists of approximately 320-330 amino acids with the characteristic seven transmembrane domain structure typical of GPCRs . The structure would include extracellular N-terminus, three extracellular loops, three intracellular loops, and an intracellular C-terminus.

Unlike some other olfactory receptors, detailed crystallographic structures of OR5AK2 have not been widely reported. Researchers investigating OR5AK2 structure should consider homology modeling approaches using better-characterized olfactory receptors as templates. Sequence alignment with OR5AL1 (328 aa) may provide initial structural insights, as similar olfactory receptors often share conserved transmembrane domains and ligand binding pockets .

What expression systems are recommended for producing recombinant OR5AK2?

For researchers seeking to produce recombinant OR5AK2, cell-free expression systems have demonstrated success with similar olfactory receptors. Based on methodologies used for OR5AL1, a cell-free expression system can yield high purity (≥85%) full-length protein suitable for SDS-PAGE analysis and functional studies . This approach circumvents many challenges associated with membrane protein expression in cellular systems.

Alternative expression systems to consider include:

Expression SystemAdvantagesChallengesApplications
Cell-freeHigh purity, rapid production, avoids toxicity issuesMay lack post-translational modificationsSDS-PAGE, structural studies
HEK293 cellsMammalian post-translational modificationsLower yield, more complex protocolFunctional assays, binding studies
Insect cellsHigher yield than mammalian cellsMore complex than cell-freeStructural studies
E. coliCost-effective, high yieldImproper folding of membrane proteinsAntigen production

For highest purity and analytical applications, the cell-free system should be considered as the primary approach based on successful application with similar olfactory receptors .

How can researchers verify the quality and functionality of recombinant OR5AK2?

Quality verification of recombinant OR5AK2 should employ multiple complementary techniques:

  • SDS-PAGE analysis to confirm molecular weight and purity (expect ≥85% purity for high-quality preparations)

  • Western blotting using anti-OR5AK2 antibodies or epitope tag antibodies if using tagged recombinant protein

  • Mass spectrometry to confirm protein identity and detect potential post-translational modifications

  • Circular dichroism to assess secondary structure, particularly alpha-helical content expected in transmembrane domains

Functional verification requires more specialized approaches:

  • Calcium mobilization assays following stimulation with potential ligands

  • GTPγS binding assays to measure G-protein activation

  • Surface plasmon resonance to measure ligand binding kinetics

  • Fluorescence-based ligand binding assays using purified receptor in nanodiscs or detergent micelles

Researchers should prioritize SDS-PAGE for initial quality assessment, followed by functional assays appropriate to their specific research questions .

What is the potential role of OR5AK2 in breast cancer and other malignancies?

Recent investigations into olfactory receptors have revealed unexpected roles in cancer biology. While OR5AK2-specific data is limited, research patterns from similar olfactory receptors provide valuable insights for researchers investigating OR5AK2 in cancer contexts.

Multiple olfactory receptors show significant transcript abundance in invasive breast carcinoma, with specific receptors (OR2B6, OR2T8, and OR2W3) demonstrating distinctive upregulation patterns that correlate with molecular breast cancer subtypes . For example, OR2B6 upregulation correlates with Luminal A subtype signatures, while OR2W3 upregulation correlates with Basal-like subtypes .

Researchers investigating OR5AK2 in breast cancer should:

  • Analyze OR5AK2 expression across breast cancer molecular subtypes (Luminal A, Luminal B, HER2-enriched, Basal-like)

  • Examine correlation between OR5AK2 expression and established cancer biomarkers (e.g., CEP55, CDH3, MLPH, GPR160)

  • Compare expression levels between tumor tissue and adjacent normal tissue

  • Investigate potential mutations in OR5AK2 in cancer samples (noting that previous studies found 31% of breast carcinoma patients had mutations in OR genes)

The significantly higher expression of some ORs in patient tumors compared to cell lines (e.g., 24-fold for OR2B6) suggests researchers should prioritize patient-derived samples over cell lines when investigating OR5AK2 in cancer contexts .

What methodologies are recommended for investigating OR5AK2 gene regulation?

Understanding OR5AK2 gene regulation requires analysis at multiple levels. Based on methodologies applied to similar olfactory receptors and OR genes in cancer contexts, researchers should consider:

  • Transcriptional regulation:

    • ChIP-seq to identify transcription factors binding to the OR5AK2 promoter

    • ATAC-seq to assess chromatin accessibility at the OR5AK2 locus

    • Promoter reporter assays to identify key regulatory elements

  • Epigenetic regulation:

    • Bisulfite sequencing to analyze DNA methylation patterns

    • ChIP-seq for histone modifications (H3K4me3, H3K27ac, H3K27me3)

    • Analysis of long non-coding RNAs that may regulate OR5AK2 expression

  • Post-transcriptional regulation:

    • RNA-seq to quantify transcript abundance in various tissues/conditions

    • FPKM analysis for accurate comparison across samples

    • miRNA binding site analysis and validation

When analyzing RNA-seq data, researchers should be aware that olfactory receptor genes showed significant upregulation in 198 out of 960 breast carcinoma cases in one study, demonstrating the importance of large sample sizes to detect subpopulation-specific effects .

How can researchers accurately identify and validate OR5AK2 ligands?

Identifying ligands for olfactory receptors remains challenging, but several complementary approaches can be employed:

  • In silico screening:

    • Homology modeling of OR5AK2 ligand binding domain

    • Virtual screening of compound libraries against the modeled binding pocket

    • Molecular dynamics simulations to assess binding stability

  • In vitro screening:

    • Cell-based calcium imaging assays with OR5AK2-expressing cells

    • BRET/FRET assays to detect conformational changes upon ligand binding

    • Surface plasmon resonance with purified receptor

  • Validation methods:

    • Dose-response curves to determine EC50 values

    • Competition assays with known ligands

    • Site-directed mutagenesis of predicted binding residues

    • Correlation of ligand binding with downstream signaling events

Researchers should be cautious about potential off-target effects and verify specificity by comparing responses in OR5AK2-expressing cells versus control cells lacking the receptor.

What approaches are recommended for investigating OR5AK2 involvement in human social behavior and neurological processes?

Emerging evidence suggests potential roles for olfactory receptors beyond olfaction, including neurological and social behavior processes. For researchers exploring OR5AK2 in these contexts:

  • Genetic association studies:

    • Analyze OR5AK2 polymorphisms in relation to social behavior phenotypes

    • Be aware that selection pressure may affect Hardy-Weinberg equilibrium in sociability genes, requiring specialized statistical approaches

    • Consider linkage disequilibrium patterns when analyzing OR5AK2 variants

  • Functional neuroimaging:

    • fMRI studies comparing neural activation patterns in subjects with different OR5AK2 genotypes

    • Combined EEG/fMRI to capture temporal and spatial aspects of neural responses

  • Molecular approaches:

    • Single-cell RNA sequencing to identify neuronal populations expressing OR5AK2

    • Spatial transcriptomics to map OR5AK2 expression in brain regions

    • CRISPR-Cas9 editing to study effects of OR5AK2 knockout in neuronal models

When conducting genetic studies, researchers should be cautious about removing SNPs that deviate from Hardy-Weinberg equilibrium, as this may inadvertently exclude variants under selection pressure . Between 14.66% and 30.61% of SNPs violating HWE were found to be in moderate linkage with other such SNPs, suggesting potential selection effects rather than genotyping errors .

How can researchers effectively analyze the evolutionary conservation and selection patterns of OR5AK2?

Understanding evolutionary aspects of OR5AK2 provides insights into its functional significance. Recommended approaches include:

  • Comparative genomics:

    • Multi-species sequence alignment to identify conserved domains

    • Calculation of dN/dS ratios to detect selection signatures

    • Identification of species-specific variations in key functional regions

  • Population genetics:

    • Analysis of OR5AK2 variation across human populations

    • Tests for selection (Tajima's D, Fst, iHS, XP-EHH)

    • Caution when filtering variants that deviate from Hardy-Weinberg equilibrium, as this may remove signatures of selection

  • Structural biology integration:

    • Mapping conserved residues onto structural models

    • Correlating evolutionary conservation with functional domains

    • Identifying co-evolving residues that may interact functionally

Analysis TypeKey MetricsInterpretationPotential Confounders
Purifying SelectiondN/dS < 1Functional constraintBackground selection
Positive SelectiondN/dS > 1Adaptive evolutionRelaxed constraint
Balancing SelectionHigh heterozygosityMaintenance of polymorphismPopulation structure
Recent SelectionExtended haplotypesRecent selective sweepDemographic effects

Researchers should note that olfactory receptors as a gene family show complex evolutionary patterns, with both conservation of functional domains and rapid evolution of ligand binding regions .

What technical considerations are important when designing expression vectors for OR5AK2 studies?

When designing expression vectors for OR5AK2 studies, researchers should consider:

  • Vector design elements:

    • Strong promoters appropriate for the expression system (CMV for mammalian cells, T7 for cell-free)

    • Kozak sequence optimization for efficient translation initiation

    • Codon optimization for the expression system

    • Inclusion of epitope tags (N-terminal or C-terminal) for detection and purification

    • Fusion partners to enhance folding and membrane localization

  • Critical domains:

    • Based on studies of similar proteins like Orc2, researchers should identify and preserve nuclear localization signals if studying nuclear functions

    • Preserve the ORC assembly domain equivalents in OR5AK2 if studying protein-protein interactions

    • Consider chimeric approaches with well-expressed GPCRs to enhance surface expression

  • Expression verification:

    • Western blotting to confirm expression levels

    • Immunofluorescence to verify cellular localization

    • Functional assays to confirm activity of the recombinant protein

For optimal results, researchers should consider testing multiple construct designs in parallel, varying tag positions and including or excluding predicted signal sequences to determine the optimal configuration for their specific application.

What are common pitfalls in OR5AK2 research and how can they be addressed?

Researchers working with OR5AK2 should anticipate and prepare for several common challenges:

  • Expression and solubility issues:

    • Problem: Poor expression or inclusion body formation

    • Solution: Try cell-free expression systems that have shown success with similar olfactory receptors

    • Alternative: Use detergent screening to identify optimal solubilization conditions

  • Functional assay sensitivity:

    • Problem: Low signal-to-noise ratio in functional assays

    • Solution: Implement high-sensitivity detection methods (BRET, FRET, or calcium imaging with fluorescent indicators)

    • Alternative: Amplify signal using chimeric G proteins or β-arrestin recruitment assays

  • Ligand identification challenges:

    • Problem: Difficulty identifying physiological ligands

    • Solution: Start with broad chemical screens followed by structural refinement

    • Alternative: Consider using bioinformatic prediction based on similar olfactory receptors with known ligands

  • Antibody specificity:

    • Problem: Cross-reactivity with other olfactory receptors

    • Solution: Use epitope-tagged recombinant proteins and tag-specific antibodies

    • Alternative: Validate antibodies using knockout or knockdown controls

  • Genetic analysis limitations:

    • Problem: Removal of potentially important variants that deviate from HWE

    • Solution: Consider separate analysis of HWE-deviating SNPs, especially those in linkage disequilibrium with other such SNPs

    • Alternative: Implement specialized statistical approaches for variants under potential selection

How should researchers approach data analysis when studying OR5AK2 expression in disease contexts?

When analyzing OR5AK2 expression data in disease contexts, researchers should implement rigorous analytical approaches:

  • Expression quantification:

    • Use FPKM (Fragments Per Kilobase Million) or TPM (Transcripts Per Million) for accurate comparison across samples

    • Implement appropriate normalization methods for the specific platform used

    • Consider spike-in controls for absolute quantification

  • Statistical analysis:

    • Calculate both sum upregulation and weighted upregulation metrics as used in breast cancer studies

    • Determine appropriate significance thresholds based on dataset characteristics

    • Compare both prevalence (number of cases showing upregulation) and magnitude of upregulation

  • Subgroup analysis:

    • Perform hierarchical clustering to identify potential OR5AK2 expression patterns across patient subgroups

    • Correlate OR5AK2 expression with established molecular subtypes and biomarkers

    • Analyze potential co-expression patterns with other relevant genes

  • Validation approaches:

    • Confirm RNA-seq findings with qRT-PCR in independent samples

    • Validate protein expression using immunohistochemistry or western blotting

    • Correlate expression with clinical outcomes where possible

Studies of olfactory receptors in breast cancer found that combining analyses of both upregulation magnitude and prevalence across patients was effective in identifying biologically relevant patterns . This combined approach is recommended for OR5AK2 studies.

What are the most promising future research directions for OR5AK2?

Based on current knowledge of olfactory receptors and their expanding roles beyond traditional olfaction, several promising research directions for OR5AK2 emerge:

  • Cancer biology:

    • Investigate OR5AK2 as a potential biomarker or therapeutic target in specific cancer subtypes

    • Explore mechanisms by which OR5AK2 may influence cancer cell proliferation or migration

    • Develop high-throughput screening methods to identify OR5AK2 modulators with potential therapeutic applications

  • Neurobiology and behavior:

    • Explore potential roles of OR5AK2 in neuronal development or function

    • Investigate genetic associations between OR5AK2 variants and social or behavioral phenotypes

    • Develop neuroimaging protocols to correlate OR5AK2 genotypes with functional brain activity

  • Structural biology:

    • Determine high-resolution structure of OR5AK2 using cryo-EM or X-ray crystallography

    • Identify key residues involved in ligand binding through systematic mutagenesis

    • Develop computational models to predict novel ligands based on structural insights

  • Evolutionary genomics:

    • Analyze patterns of OR5AK2 conservation and diversification across species

    • Investigate evidence for selection pressure on OR5AK2 in human populations

    • Explore potential co-evolution with interacting proteins or ligand sources

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.