Recombinant Human Olfactory receptor 5AR1 (OR5AR1)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression Systems

OR5AR1 has been expressed in heterologous systems for functional studies:

Expression Platforms

  • HEK293 Cells: Stable tetracycline-inducible systems enable high-yield production (~1.6 mg monomeric receptor per 60 T175 flasks) .

  • Baculovirus/Sf9 Systems: Used for large-scale production in insect cells, though not directly reported for OR5AR1 .

Purification Methods

A two-step protocol involving:

  1. Anti-FLAG Immunoaffinity Chromatography

  2. Size Exclusion Chromatography (SEC) with multi-angle light scattering (MALS) to isolate monomeric/dimeric forms .

Functional Insights

While OR5AR1’s specific ligands remain unidentified, functional parallels exist with related olfactory receptors:

Key Findings

  • Ligand Binding: Intrinsic tryptophan fluorescence assays suggest micromolar-range affinity for odorants in homologous receptors .

  • Signaling Pathways: Activation likely triggers cAMP-mediated or calcium-dependent pathways, as seen in other ORs .

  • Ectopic Roles: ORs in non-olfactory tissues (e.g., prostate, kidney) regulate processes like cell migration and hormone secretion, though OR5AR1’s roles here are unconfirmed .

Research Applications

OR5AR1 is studied using tools such as:

ToolApplicationSource
ELISA Kits (ABIN1749696)Quantification in plasma, serum, or tissuesAntibodies-Online
Anti-OR5AR1 AntibodiesWestern blot, immunofluorescenceSigma-Aldrich
shRNA/siRNAGene knockdown in functional assaysLSBio

Challenges and Future Directions

  • Ligand Identification: High-throughput screening is needed to identify OR5AR1-specific agonists/antagonists .

  • Structural Studies: Cryo-EM or crystallography could resolve activation mechanisms.

  • Clinical Relevance: Potential roles in cancer or metabolic diseases remain unexplored, unlike OR2B6 in breast cancer or OR51E1 in prostate cancer .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference when placing the order. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR5AR1; Olfactory receptor 5AR1; Olfactory receptor OR11-209
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR5AR1
Target Protein Sequence
MDKENSSMVTEFIFMGITQDPQMEIIFFVVFLIVYLVNVVGNIGMIILITTDTQLHTPMY FFLCNLSFVDLGYSSAIAPRMLADFLTNHKVISFSSCATQFAFFVGFVDAECYVLAAMAY GRFVAICRPLHYSTFMSKQVCLALMLGSYLAGLVSLVAHTTLTFSLSYCGSNIINHFFCE IPPLLALSCSDTYISEILLFSLCGFIEFSTILIIFISYTFILVAIIRMRSAEGRLKAFST CGSHLTGITLFYGTVMFMYLRPTSSYSLDQDKWASVFYTVIIPMLNPLIYSLRNKDVKAA FKKLIGKKSQ
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15260

KEGG: hsa:219493

STRING: 9606.ENSP00000302639

UniGene: Hs.553633

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR5AR1 and what is its functional significance in olfactory research?

OR5AR1, also known as Olfactory receptor OR11-209, belongs to the G-protein coupled receptor 1 family and functions as an odorant receptor in the mammalian olfactory system . This receptor is part of the larger olfactory receptor family, which comprises over 2,000 alleles in mammals, making it the largest gene family in the genome . The functional significance of OR5AR1 stems from its role in the singular expression mechanism where each olfactory sensory neuron (OSN) expresses only one olfactory receptor allele from this vast repertoire . This "one neuron-one receptor" rule is fundamental to the combinatorial coding system that allows mammals to discriminate between thousands of different odors. Research on OR5AR1 provides insights into both the general mechanisms of olfactory perception and the unique regulatory features that govern olfactory receptor choice in sensory neurons .

What are the optimal storage and handling conditions for recombinant OR5AR1 protein?

Recombinant Human OR5AR1 protein requires specific storage conditions to maintain stability and functionality. The shelf life is dependent on multiple factors including storage state, buffer ingredients, and storage temperature . For liquid formulations, the recommended shelf life is 6 months when stored at -20°C or -80°C, while lyophilized forms can remain stable for up to 12 months at the same temperatures . Researchers should avoid repeated freezing and thawing cycles as this significantly decreases protein stability . Working aliquots can be stored at 4°C but should be used within one week .

For reconstitution, the manufacturer's recommendation is to briefly centrifuge the vial before opening to bring contents to the bottom, then reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Addition of glycerol to a final concentration of 5-50% is recommended before aliquoting for long-term storage, with 50% being the default concentration suggested by suppliers . These handling protocols ensure maximum retention of protein structure and function for experimental applications.

What detection methods are available for OR5AR1 in experimental systems?

Several detection methodologies are available for OR5AR1 research, each with specific applications and sensitivity ranges:

MethodDetection RangeSample TypesAdvantagesLimitations
ELISA0.156-10 ng/mlTissue homogenates, cell lysates, biological fluidsQuantitative, high throughputLess effective for native protein in complex samples
SDS-PAGE≥85% purityRecombinant protein preparationsVisual confirmation of size and purityNot quantitative for low abundance samples
ImmunohistochemistryTissue-dependentFixed tissue sectionsSpatial localization in situRequires validated antibodies

The ELISA method provides quantitative detection of OR5AR1 with a test range of 0.156-10 ng/ml, making it suitable for detecting the protein in tissue homogenates, cell lysates, and other biological fluids . For assessment of recombinant protein quality, SDS-PAGE analysis with a minimum purity threshold of 85% is commonly employed . It's important to note that these detection systems are optimized for native samples rather than recombinant proteins, and sample concentrations must be diluted to mid-range of the detection kit for accurate results .

How does OR5AR1 compare structurally to other olfactory receptors?

OR5AR1 shares structural characteristics with other members of the olfactory receptor family while maintaining unique sequence features that determine its ligand specificity. Like other olfactory receptors, OR5AR1 is a seven-transmembrane domain G-protein coupled receptor . The full-length human OR5AR1 protein consists of 328 amino acids, with specific sequence motifs that contribute to its tertiary structure and function .

The amino acid sequence of OR5AL1, another olfactory receptor in the same family, provides a useful comparison for understanding the structural diversity within this receptor class . Both receptors belong to the same family but differ in their ligand binding domains, which contributes to their differential odorant recognition properties. The transmembrane domains contain hydrophobic residues that anchor the receptor in the cell membrane, while the extracellular loops participate in odorant binding. These structural elements are critical considerations when designing experiments to study ligand-receptor interactions or expression patterns.

What experimental considerations are important when working with OR5AR1 ELISA kits?

When using OR5AR1 ELISA kits for research applications, several methodological considerations should be addressed to ensure reliable and reproducible results:

  • Sample preparation: Tissue homogenates, cell lysates, and biological fluids must be properly processed to ensure compatibility with the assay format . This may include appropriate dilution, removal of particulates, and consideration of protein extraction methods.

  • Assay validation: The stability of the kit is determined by the rate of activity loss, which should be less than 5% within the expiration date under appropriate storage conditions . To minimize performance fluctuations, operation procedures and laboratory conditions should be strictly controlled.

  • Detection limitations: The sensitivity range of 0.156-10 ng/ml dictates that sample concentrations must fall within this range for accurate quantification . Samples with concentrations outside this range require appropriate dilution.

  • Recombinant versus native protein detection: ELISA kits are typically optimized for detection of native proteins rather than recombinant versions, which may have different sequences or tertiary structures . This is an important consideration when using recombinant OR5AR1 as a standard or control.

  • Consistency: For maximum reliability, it is strongly recommended that the entire assay procedure be performed by the same researcher throughout a study to minimize variability .

How does nuclear architecture influence OR5AR1 expression in olfactory sensory neurons?

The expression of OR5AR1, like other olfactory receptors, is fundamentally linked to the nuclear architecture of olfactory sensory neurons (OSNs). Recent research has revealed that choreographed changes to OSN nuclear architecture are necessary for olfactory receptor expression . The insulated organization of OR-enhancers around an OR allele is a defining characteristic of the chosen receptor during the selection process .

The mammalian genome contains over 2,000 olfactory receptor alleles regulated by 63 known OR-Enhancer elements, yet each OSN expresses only a single OR allele . This singular expression pattern is achieved through complex nuclear dynamics that involve both activation of the chosen receptor and silencing of all other receptor genes. Innovations in single-cell and biophysics-based analysis of nuclear architecture have revised previous models of the nucleus to incorporate its dynamic and probabilistic nature .

These advances suggest that OR5AR1 expression is regulated by:

  • Three-dimensional chromatin organization that brings enhancer elements into proximity with the OR5AR1 gene

  • Epigenetic modifications that permit activation of OR5AR1 while maintaining repression of other OR genes

  • Probabilistic interactions between nuclear factors and regulatory elements that contribute to the stochastic selection process

Understanding these nuclear mechanisms provides critical context for experimental designs aimed at studying OR5AR1 expression patterns or manipulating its expression in model systems .

What methodological approaches are most effective for studying OR5AR1 function in vitro?

Studying OR5AR1 function in vitro presents several challenges due to the specialized nature of olfactory signaling and the complex membrane properties of olfactory receptors. Effective methodological approaches must address these challenges while providing reliable and physiologically relevant data.

For functional studies of recombinant OR5AR1, researchers should consider:

  • Expression systems: Mammalian cell lines are the preferred expression system for OR5AR1 to ensure proper post-translational modifications and membrane insertion . Cell-free systems can be used for structural studies but may not preserve functional properties .

  • Protein solubilization: As a membrane protein, OR5AR1 requires appropriate detergents or lipid environments to maintain its native conformation. Reconstitution into proteoliposomes or nanodiscs may provide a more native-like environment for functional studies.

  • Ligand screening approaches: Calcium imaging, BRET (Bioluminescence Resonance Energy Transfer), or electrophysiological recordings can be used to measure receptor activation in response to potential ligands.

  • Controls for specificity: Closely related olfactory receptors should be included as controls to demonstrate the specificity of ligand-receptor interactions.

  • Signal transduction coupling: Co-expression with appropriate G-proteins and downstream signaling components is essential for functional readouts of receptor activation.

These methodological considerations help overcome the inherent difficulties in working with olfactory receptors in artificial systems and increase the physiological relevance of in vitro findings .

How can OR5AR1 be used as a model system for understanding singular olfactory receptor expression?

OR5AR1 provides an excellent model system for investigating the mechanisms underlying singular olfactory receptor expression—a fundamental principle in olfactory system organization. Each olfactory sensory neuron expresses only one OR allele out of over 2,000 possibilities, a phenomenon that remains one of the most intriguing questions in sensory neurobiology .

To utilize OR5AR1 as a model system, researchers can implement the following experimental approaches:

  • Single-cell transcriptomics: This approach allows for the identification of neurons expressing OR5AR1 and characterization of their transcriptional profiles, providing insights into the factors that may contribute to receptor choice .

  • Chromatin immunoprecipitation (ChIP): Targeted ChIP experiments can reveal the epigenetic landscape around the OR5AR1 locus in expressing versus non-expressing cells, illuminating the chromatin-level regulation of singular expression.

  • Chromosome conformation capture techniques (3C, 4C, Hi-C): These methods can map the three-dimensional interactions between OR5AR1 and its enhancer elements, offering insights into the spatial organization that facilitates singular expression .

  • CRISPR-Cas9 genome editing: Targeted modifications of the OR5AR1 locus or its regulatory elements can test hypotheses about sequence-specific determinants of receptor choice.

  • Live cell imaging with fluorescent reporters: Tracking the dynamics of OR5AR1 expression in developing olfactory neurons can reveal temporal aspects of the selection process.

These approaches collectively provide a comprehensive toolkit for using OR5AR1 to elucidate the mechanisms that ensure the "one neuron-one receptor" rule in the olfactory system .

What sensory analysis protocols can incorporate OR5AR1 studies in relation to odorant detection?

Integrating OR5AR1 research into broader sensory analysis protocols requires bridging molecular-level receptor studies with perceptual and physiological responses to odorants. Several methodological approaches can effectively connect OR5AR1 function to sensory perception:

  • Correlation of OR5AR1 activation patterns with psychophysical data: By comparing the in vitro responses of OR5AR1 to various odorants with human sensory perception of the same compounds, researchers can establish structure-activity relationships relevant to olfactory coding .

  • Threshold determination protocols: Sensory tests designed to identify detection thresholds for odorants can be combined with OR5AR1 binding affinity data to understand how receptor sensitivity translates to perceptual sensitivity .

  • Descriptive sensory analysis: Trained panelists can provide standardized descriptions of odor qualities that can be correlated with OR5AR1 activation patterns, potentially revealing how specific receptor activation contributes to qualitative aspects of odor perception .

  • Objective physiological measurements: Recording from olfactory sensory neurons expressing OR5AR1 during odorant exposure provides a direct link between molecular recognition and neural encoding of olfactory information .

  • Cross-modal sensory interactions: Protocols that examine how visual or taste information affects olfactory perception can investigate whether OR5AR1-mediated olfactory signals are subject to similar cross-modal influences .

These integrated approaches allow researchers to connect molecular events at the receptor level with the complex perceptual experiences that define olfactory function .

What variables must be controlled in experimental designs focused on OR5AR1 functional studies?

Controlling experimental variables is crucial for generating reliable and reproducible data in OR5AR1 functional studies. The following variables require particular attention:

  • Protein quality and integrity: The purity (>85% by SDS-PAGE) and structural integrity of recombinant OR5AR1 must be verified before functional studies . Degradation or misfolding can lead to false negative results in binding or activation assays.

  • Environmental conditions: Temperature, pH, and ionic strength significantly impact membrane protein stability and function. These parameters should be standardized across experiments, with appropriate controls to verify that conditions remain within the physiological range relevant to olfactory receptors .

  • Expression levels: Variations in receptor expression can affect functional readouts. Quantitative measures of OR5AR1 expression should be included to normalize functional data across different experimental conditions or cell populations .

  • Signal transduction components: The presence and activity of G-proteins and downstream signaling molecules must be controlled to ensure that differences in response reflect receptor-level events rather than variations in the signaling cascade .

  • Ligand preparation and delivery: Odorant compounds often have limited solubility and stability in aqueous solutions. Standardized methods for preparing and delivering odorant stimuli are essential for reproducible activation profiles .

  • Cross-contamination prevention: Given the high sensitivity of olfactory receptors, rigorous controls against odorant cross-contamination are necessary, including the use of separate equipment and preparation areas for different compounds .

What are the recommended reconstitution protocols for recombinant OR5AR1?

Proper reconstitution of recombinant OR5AR1 is critical for maintaining structural integrity and functional activity. Based on manufacturer guidelines, the following protocol is recommended:

  • Sample preparation: Briefly centrifuge the vial containing lyophilized OR5AR1 prior to opening to bring all contents to the bottom of the tube .

  • Reconstitution solution: Use deionized sterile water for initial reconstitution of the protein . This maintains a neutral pH environment that prevents protein denaturation.

  • Concentration: Reconstitute to a final concentration of 0.1-1.0 mg/mL for optimal stability and handling . Higher concentrations may lead to protein aggregation, while lower concentrations may result in excessive adherence to container surfaces.

  • Stabilization: Add glycerol to a final concentration of 5-50% after reconstitution . A 50% glycerol concentration is generally recommended as it provides cryoprotection and prevents freeze-thaw damage during storage .

  • Aliquoting: Divide the reconstituted protein into small working aliquots to avoid repeated freeze-thaw cycles . Each aliquot should contain only the amount needed for a single experiment.

  • Storage: Store reconstituted aliquots at -20°C or -80°C for long-term storage (up to 6 months for solutions with glycerol) . Working aliquots can be stored at 4°C but should be used within one week .

This reconstitution protocol ensures maximum retention of OR5AR1 structure and function for subsequent experimental applications while minimizing degradation during storage and handling.

How should researchers design experiments to study OR5AR1 ligand binding properties?

Designing rigorous experiments to characterize OR5AR1 ligand binding requires careful consideration of multiple factors to ensure physiologically relevant and reproducible results:

  • Expression system selection: For functional ligand binding studies, mammalian cell systems that support proper folding and trafficking of olfactory receptors are preferred . HEK293 cells with accessory factors like Receptor Transporting Protein (RTP) family members can enhance surface expression.

  • Positive and negative controls: Include known ligands for closely related olfactory receptors as positive controls and structurally dissimilar compounds as negative controls to establish assay specificity.

  • Concentration-response relationships: Test potential ligands across a wide concentration range (typically 10 nM to 1 mM) to establish complete dose-response curves that can reveal both high and low-affinity interactions.

  • Multiple readout systems: Employ orthogonal assays to confirm binding interactions:

    • Calcium imaging for functional responses

    • Competitive binding assays with labeled reference ligands

    • Conformational change assays using BRET or FRET-based sensors

  • Data analysis: Apply appropriate mathematical models to determine binding parameters:

    • EC50/IC50 values for activation/inhibition

    • Hill coefficients to assess cooperativity

    • Schild analysis for potential allosteric interactions

  • Replication and validation: Perform at least three independent experiments with technical replicates to ensure statistical robustness. Validate key findings using alternative approaches or in different expression systems.

  • Physiological relevance: Correlate in vitro binding data with ex vivo responses in isolated olfactory neurons or in vivo behavioral responses when possible.

This experimental design framework provides a comprehensive approach to characterizing the ligand binding properties of OR5AR1 while addressing the inherent challenges of working with olfactory receptors .

What quality control measures should be implemented for OR5AR1 research?

Implementing rigorous quality control measures is essential for generating reliable and reproducible results in OR5AR1 research. The following quality control framework addresses key aspects of protein quality, experimental consistency, and data validation:

  • Protein quality assessment:

    • Purity verification via SDS-PAGE (minimum 85% purity)

    • Structural integrity confirmation through circular dichroism or limited proteolysis

    • Functional activity validation using known ligands or antibodies

    • Batch-to-batch consistency testing when using commercial preparations

  • Experimental standardization:

    • Consistent laboratory conditions (temperature, humidity, time of day)

    • Standardized protocols with detailed documentation of each step

    • Use of the same researcher throughout a study to minimize technical variation

    • Regular calibration of equipment and instruments

  • Sample handling and storage:

    • Strict adherence to recommended storage temperatures (-20°C/-80°C for long-term)

    • Prevention of repeated freeze-thaw cycles by using working aliquots

    • Tracking of sample age and shelf-life (6 months for liquid form, 12 months for lyophilized)

    • Documentation of reconstitution date and conditions

  • Data validation approaches:

    • Inclusion of appropriate positive and negative controls in each experiment

    • Technical replicates (minimum of three) within each experiment

    • Biological replicates (minimum of three) across independent experiments

    • Statistical analysis appropriate for the experimental design and data distribution

  • Reporting standards:

    • Comprehensive methods documentation including protein source, catalog numbers, and lot numbers

    • Transparent reporting of all data, including outliers

    • Sharing of raw data when possible to enhance reproducibility

How can researchers integrate OR5AR1 studies with broader olfactory system research?

Integrating OR5AR1 studies with broader olfactory system research requires connecting molecular mechanisms to cellular, circuit, and behavioral levels of analysis. The following methodological approaches facilitate this integration:

This integrated approach allows researchers to position OR5AR1 studies within the broader context of olfactory system function, connecting molecular events at the receptor level to the complex neural processes that underlie olfactory perception and behavior .

What statistical approaches are most appropriate for analyzing OR5AR1 functional data?

  • Dose-response analysis:

    • Nonlinear regression models (four-parameter logistic function) for determining EC50 values

    • Comparison of dose-response curves using extra sum-of-squares F test

    • Analysis of Hill coefficients to assess cooperativity in ligand binding

  • Variability assessment:

    • Calculation of coefficient of variation (CV) to quantify assay reproducibility

    • Implementation of Bland-Altman plots to compare methods or replicates

    • Utilization of intraclass correlation coefficients for assessing reliability

  • Comparative analysis:

    • ANOVA with appropriate post-hoc tests for comparing responses to multiple ligands

    • Paired t-tests for comparing before/after treatments on the same preparation

    • Non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) when normality assumptions are violated

  • Multivariate approaches:

    • Principal component analysis (PCA) for identifying patterns in OR5AR1 responses to odorant panels

    • Hierarchical clustering to group ligands based on activation profiles

    • Partial least squares regression for relating chemical structures to receptor activation

  • Robust statistical practices:

    • A priori power analysis to determine appropriate sample sizes

    • Control for multiple comparisons using Bonferroni, Holm-Sidak, or false discovery rate methods

    • Reporting of effect sizes alongside p-values to assess biological significance

  • Data visualization:

    • Box plots showing distribution characteristics of response data

    • Heat maps for visualizing responses across multiple experimental conditions

    • Forest plots for meta-analysis of results across multiple studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.