Recombinant Human Olfactory receptor 5B21 (OR5B21)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant OR5B21 refers to a laboratory-engineered version of the olfactory receptor 5B21, generated using expression systems such as E. coli, yeast, or mammalian cells . This protein retains the 7-transmembrane domain structure characteristic of G protein-coupled receptors (GPCRs) . Key production variants include:

Product CodeSourceConjugate/TagPurityApplication
CSB-EP016910HU1-BE. coliAvi-tag Biotinylated>85%Binding assays, ELISA
CSB-YP016910HU1YeastUnconjugatedN/AStructural studies
CSB-BP016910HU1BaculovirusUnconjugatedN/AFunctional assays

These variants enable diverse experimental applications, including protein interaction studies and metastasis research .

Role in Breast Cancer Metastasis

  • Overexpression: OR5B21 transcript levels are elevated in metastatic breast cancer cells targeting the brain, bone, and lung .

  • Knockdown effects: Silencing OR5B21 reduces invasion and metastasis by 60–70% in preclinical models .

  • Mechanism: Activates EMT, enabling cancer cells to detach from primary tumors and colonize distant organs .

Signaling Pathways

Pathway ComponentFunction in OR5B21 Signaling
STAT3Promotes cell proliferation
NF-κBEnhances inflammatory responses
CEBPβDrives metastatic gene expression

These pathways collectively prime cancer cells for dissemination .

Antibodies and ELISA Kits

  • Anti-OR5B21 Antibodies: Used for Western blot (WB) and immunohistochemistry (IHC). Examples:

    • Anti-OR5B21 (aa 40–93): Detects native human OR5B21 in WB/ELISA .

    • OR5BL Rabbit Polyclonal Antibody: Cross-reactive with mouse and rat orthologs .

  • ELISA Kits: Detect OR5B21 in tissue homogenates with a sensitivity range of 0.156–10 ng/ml .

Recombinant Protein Applications

  • Drug screening: Identifies inhibitors targeting OR5B21’s transmembrane domains .

  • Metastasis studies: Used in vitro to model breast cancer cell migration .

Clinical Implications

OR5B21 is proposed as a therapeutic target for adjuvant therapies to block metastasis . Current efforts focus on:

  • Developing small-molecule inhibitors against its ligand-binding pocket.

  • Exploring siRNA-based knockdown to suppress EMT in aggressive cancers .

Future Directions

  • Structural studies: Solving OR5B21’s 3D structure to design targeted therapies .

  • Ligand identification: Uncovering physiological or synthetic ligands that modulate its activity .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand that specific requirements may arise. If you have any particular format preferences, please ensure you clearly specify them when placing your order, and we will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. For precise delivery estimates, please consult your local distributors.
Note: Our standard shipping procedure includes normal blue ice packs. If you require dry ice shipping, please communicate this need to us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein using deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. For lyophilized formulations, the shelf life extends to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during the production phase. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag type for your order.
Synonyms
OR5B21; Olfactory receptor 5B21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
OR5B21
Target Protein Sequence
MENSTEVTEFILLGLTDDPNLQIPLLLAFLFIYLITLLGNGGMMVIIHSDSHLHTPMYFF LSNLSLVDLGYSSAVAPKTVAALRSGDKAISYDGCAAQFFFFVGFATVECYLLASMAYDR HAAVCRPLHYTTTMTAGVCALLATGSYVSGFLNASIHAAGTFRLSFCGSNEINHFFCDIP PLLALSCSDTRISKLVVFVAGFNVFFTLLVILISYFFICITIQRMHSAEGQKKVFSTCAS HLTALSIFYGTIIFMYLQPNSSQSVDTDKIASVFYTVVIPMLNPLIYSLRNKEVKSALWK ILNKLYPQY
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 19616

KEGG: hsa:219968

STRING: 9606.ENSP00000353537

UniGene: Hs.553647

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfactory Receptor 5B21 and what is its significance in cancer research?

Olfactory Receptor 5B21 (OR5B21) is a member of the olfactory receptor family traditionally associated with the sense of smell. While olfactory receptors typically line the nasal cavity and relay sensory data to the brain for odor recognition, research has revealed that OR5B21 plays essential roles beyond the nasal epithelium, particularly in cancer progression. The significance of OR5B21 in cancer research has emerged from studies demonstrating its increased transcript abundance in metastatic breast cancer sites compared to primary tumors. This receptor has been identified as a novel oncogene that contributes specifically to breast cancer metastasis to the brain, bone, and lung, making it a valuable target for studying metastatic mechanisms and developing potential adjuvant therapies for breast cancer . The unique function of OR5B21 in cancer progression challenges the conventional perception that olfactory receptors serve exclusively in olfactory sensation, expanding our understanding of their diverse physiological roles.

How is OR5B21 detected and quantified in laboratory settings?

In laboratory settings, OR5B21 can be detected and quantified through several methodological approaches. The most common technique is Enzyme-Linked Immunosorbent Assay (ELISA), with commercially available kits specifically designed for Human Olfactory receptor 5B21. These kits typically employ a colorimetric detection method with a test range of 0.156 ng/ml to 10 ng/ml . When using ELISA, researchers should ensure sample concentrations are diluted to the mid-range of the kit specifications for accurate results.

For transcript-level detection and quantification, quantitative PCR (qPCR) is commonly employed to measure OR5B21 mRNA expression levels in tissue samples or cell lines. In research settings examining the role of OR5B21 in cancer progression, transcript abundance analysis has been crucial in comparing expression between primary tumors and metastatic sites in the brain, bone, and lung . Beyond these approaches, western blotting using specific antibodies against OR5B21 can be utilized to detect protein expression, while immunohistochemistry enables visualization of receptor expression patterns in tissue samples. When designing experiments to detect OR5B21, researchers should consider that detection optimization may be necessary for different sample types including tissue homogenates, cell lysates, and other biological fluids.

What are the reference parameters for OR5B21 in experimental design?

When designing experiments involving OR5B21, researchers should reference several key parameters to ensure reliable and reproducible results. The gene symbol is OR5B21 with GeneID 219968 and HGNC 19616. For protein-level studies, the UniProt Primary AC is A6NL26 with UniProt Entry Name OR5BL_HUMAN . These reference identifiers are essential for database searches, primer design, and protein analysis.

For quantitative assays, the typical detection range for ELISA kits is 0.156 ng/ml to 10 ng/ml, which establishes appropriate dilution parameters for sample preparation. When measuring OR5B21 expression in metastatic sites versus primary tumors, researchers should consider that significant differential expression has been observed across multiple metastatic locations including brain, bone, and lung tissues .

In functional studies examining OR5B21's role in cancer metastasis, experimental designs should include appropriate controls for knockdown and overexpression experiments. Previous research has established experimental paradigms where knockdown of OR5B21 decreases invasion and migration of breast cancer cells, while increased transcript abundance produces the opposite effect . These established parameters serve as important benchmarks for validating experimental outcomes in new research settings.

What is the mechanism by which OR5B21 promotes breast cancer metastasis?

The molecular mechanism through which OR5B21 promotes breast cancer metastasis involves the activation of epithelial to mesenchymal transition (EMT) via the STAT3/NF-κB/CEBPβ signaling axis . This complex signaling cascade begins with OR5B21 activation, which triggers a series of downstream molecular events that fundamentally alter cellular phenotype and behavior.

Research has demonstrated that OR5B21 enhances or primes breast cancer cells to metastasize by activating EMT, a process that induces multiple biochemical and phenotypical changes in the olfactory cells . These changes include enhanced migratory capacity to distant organs, particularly the brain. The EMT process involves:

  • Loss of epithelial cell-cell adhesion properties

  • Acquisition of mesenchymal characteristics

  • Increased motility and invasiveness

  • Enhanced resistance to apoptosis

At the molecular level, the STAT3/NF-κB/CEBPβ signaling axis activated by OR5B21 regulates the expression of key EMT transcription factors and markers. STAT3 activation promotes the expression of genes associated with cancer cell survival and proliferation. NF-κB activation contributes to inflammatory processes that facilitate metastasis. CEBPβ (CCAAT/enhancer-binding protein beta) further modulates gene expression programs that support the metastatic phenotype .

This mechanistic understanding explains experimental observations where knockdown of OR5B21 significantly decreased invasion and migration of breast cancer cells, while increasing OR5B21 transcript abundance had the opposite effect . The elucidation of this mechanism provides potential targets for therapeutic intervention in the OR5B21-mediated metastatic pathway.

How can researchers effectively design OR5B21 knockdown and overexpression experiments?

Designing effective OR5B21 knockdown and overexpression experiments requires careful consideration of multiple methodological factors to ensure reliable and interpretable results. For knockdown studies, researchers can employ several approaches:

siRNA/shRNA-mediated knockdown:

  • Design multiple siRNA/shRNA sequences targeting different regions of OR5B21 mRNA

  • Include non-targeting control sequences

  • Validate knockdown efficiency at both mRNA (qRT-PCR) and protein levels (western blot)

  • Optimize transfection conditions specific to the breast cancer cell lines being studied

  • Consider stable knockdown using lentiviral shRNA systems for long-term studies

CRISPR-Cas9 gene editing:

  • Design guide RNAs targeting exonic regions of OR5B21

  • Include appropriate control guide RNAs

  • Validate gene editing efficiency through sequencing

  • Isolate and expand clonal populations

  • Confirm complete knockout at the protein level

For overexpression studies:

When designing functional assays to assess the impact of OR5B21 modulation, researchers should include:

  • Cell proliferation assays

  • Migration assays (wound healing, transwell)

  • Invasion assays (Matrigel-coated transwell)

  • 3D organoid cultures to assess morphological changes

  • In vivo metastasis models using immunocompromised mice

To examine the impact on signaling pathways, assess changes in the STAT3/NF-κB/CEBPβ axis through:

  • Phosphorylation status by western blot

  • Nuclear translocation by immunofluorescence

  • Transcriptional activity using luciferase reporter assays

  • ChIP assays to examine promoter binding

Previous research has established that these approaches can effectively demonstrate the functional significance of OR5B21 in breast cancer metastasis, providing a methodological framework for new investigations .

What are the challenges in studying OR5B21's role across different metastatic sites?

Studying OR5B21's role across different metastatic sites presents several methodological and conceptual challenges that researchers must address to generate reliable data. These challenges span from sample collection to functional analysis and interpretation of site-specific effects.

Sample acquisition and preparation challenges:

  • Limited availability of matched primary tumor and metastatic samples from the same patient

  • Heterogeneity within metastatic sites affecting OR5B21 expression analysis

  • Different tissue microenvironments requiring customized processing protocols

  • Preservation of receptor integrity during sample preparation

Experimental design challenges:

  • Developing appropriate in vitro models that recapitulate organ-specific metastatic niches

  • Creating animal models that reliably develop metastases to specific organs

  • Controlling for confounding variables that affect metastatic tropism

  • Distinguishing between OR5B21-dependent and independent mechanisms

Analytical challenges:

  • Quantifying site-specific differences in OR5B21 expression levels

  • Identifying tissue-specific binding partners and signaling components

  • Normalizing data across different tissue types for valid comparisons

  • Correlating in vitro findings with in vivo observations

Research has shown differential expression of OR5B21 across metastatic sites, with particularly strong association with brain metastasis . This suggests potential tissue-specific mechanisms that remain to be fully elucidated. While OR5B21 displayed increased transcript abundance in all three major metastatic sites (brain, bone, and lung) compared with primary tumors, the magnitude of increase and functional consequences may vary between sites .

To address these challenges, researchers should employ multi-omics approaches combining transcriptomics, proteomics, and metabolomics across different metastatic sites. Additionally, organ-specific 3D culture systems and organoid models can help bridge the gap between simplified in vitro experiments and complex in vivo metastasis models.

How should researchers validate OR5B21 antibodies for experimental use?

Validation of OR5B21 antibodies is critical for ensuring reliable experimental results, particularly given the challenges associated with olfactory receptor detection. A comprehensive validation approach should include multiple complementary techniques and appropriate controls.

Essential validation steps include:

  • Specificity testing:

    • Western blot analysis using positive controls (tissues/cells known to express OR5B21) and negative controls (knockout/knockdown samples)

    • Immunoprecipitation followed by mass spectrometry to confirm target identity

    • Peptide competition assays to verify epitope specificity

    • Cross-reactivity testing against closely related olfactory receptors

  • Sensitivity assessment:

    • Titration experiments to determine optimal antibody concentration

    • Detection limit determination using purified recombinant OR5B21 protein

    • Signal-to-noise ratio evaluation across different sample types

  • Application-specific validation:

    • For immunohistochemistry: Compare staining patterns with mRNA expression (ISH)

    • For flow cytometry: Parallel analysis with fluorescent protein-tagged OR5B21

    • For immunofluorescence: Co-localization with tagged constructs or organelle markers

  • Reproducibility verification:

    • Testing across different lots of the same antibody

    • Comparison between different antibodies targeting distinct epitopes of OR5B21

    • Assessment of results across different experimental conditions

When working with commercially available ELISA kits for OR5B21, researchers should note that these kits are typically optimized for detection of native samples rather than recombinant proteins, as tertiary structures may differ . For recombinant OR5B21 studies, additional validation steps such as epitope tag detection in parallel with OR5B21 antibody detection can provide confirmation of specificity.

What are the optimal cell models for studying OR5B21 function in metastasis research?

Selecting optimal cell models for studying OR5B21 function in metastasis research requires careful consideration of several factors to ensure physiological relevance and experimental reproducibility. Based on the current literature, the following cell models offer distinct advantages for investigating OR5B21's role in breast cancer metastasis:

Human breast cancer cell lines:

  • Triple-negative breast cancer (TNBC) cell lines: MDA-MB-231 and its organ-specific metastatic variants (e.g., brain-seeking MDA-MB-231-BR) provide valuable models for studying aggressive metastatic behavior

  • Luminal breast cancer lines: MCF-7 and T47D can be used to investigate hormone-dependent contexts

  • HER2-amplified lines: SK-BR-3 and BT-474 allow examination of OR5B21 function in HER2-driven metastasis

Cell line selection considerations:

  • Baseline OR5B21 expression levels

  • Metastatic potential to brain, bone, and lung

  • Amenability to genetic manipulation (transfection efficiency, CRISPR editing)

  • Growth characteristics in 2D and 3D culture systems

Advanced model systems:

  • Patient-derived xenografts (PDX): Maintain tumor heterogeneity and more closely recapitulate clinical disease

  • Organoid cultures: Enable study of OR5B21 in 3D architectures that better represent in vivo conditions

  • Co-culture systems: Incorporate stromal or immune components to study microenvironmental influences

When designing experiments with these models, researchers should note that cellular context significantly impacts OR5B21 function. For instance, studies have shown that OR response can be assay-dependent, with ligands successfully identified in one cell line (e.g., LNCaP prostate carcinoma cells) but not recognized when the same receptors are expressed in another line (e.g., HEK293) .

For optimal results in OR5B21 functional studies, experimental design should include:

  • Validation of OR5B21 expression in chosen models

  • Comparison of multiple cell lines to identify conserved mechanisms

  • Use of organ-specific metastasis models when studying tropism to brain, bone, or lung

  • Integration of appropriate positive controls for EMT processes and STAT3/NF-κB/CEBPβ signaling activation

  • Consideration of ligand concentrations, as concentration significantly influences OR activation

These methodological considerations will enhance the reliability and translational relevance of findings regarding OR5B21's role in breast cancer metastasis.

What techniques are recommended for quantifying OR5B21's impact on metastatic potential?

Quantifying OR5B21's impact on metastatic potential requires a multi-faceted approach that combines in vitro, ex vivo, and in vivo techniques to comprehensively assess the receptor's influence on various aspects of the metastatic cascade. The following methodological approaches are recommended based on current research practices:

In vitro quantification techniques:

  • Migration assays:

    • Transwell migration assays to measure directional cell movement

    • Wound healing/scratch assays to assess collective cell migration

    • Time-lapse microscopy with cell tracking for detailed migration dynamics

    • Quantification metrics: Migration index, wound closure rate, cell velocity

  • Invasion assays:

    • Matrigel-coated transwell assays to measure invasive capacity

    • 3D spheroid invasion assays in extracellular matrix

    • Quantification metrics: Invasion index, invasive distance, degradation area

  • Adhesion and detachment assays:

    • Evaluation of cell attachment to various extracellular matrix components

    • Mechanical detachment assays to measure adhesion strength

    • Quantification metrics: Adhesion efficiency, detachment force required

  • EMT marker analysis:

    • Quantitative assessment of epithelial markers (E-cadherin, ZO-1) and mesenchymal markers (N-cadherin, Vimentin)

    • EMT transcription factor expression (Snail, Slug, Twist)

    • Quantification metrics: Protein expression ratios, mRNA expression levels

Ex vivo techniques:

  • Organotypic slice cultures:

    • Brain, bone, or lung tissue slices co-cultured with OR5B21-manipulated breast cancer cells

    • Quantification metrics: Invasion depth, proliferation within tissue

  • Circulating tumor cell (CTC) models:

    • Isolation and characterization of CTCs from blood

    • Assessment of OR5B21 expression in CTCs

    • Quantification metrics: CTC count, CTC cluster formation, EMT status

In vivo quantification methods:

  • Experimental metastasis models:

    • Tail vein injection for lung metastasis

    • Intracardiac injection for bone and brain metastasis

    • Quantification metrics: Metastatic burden (number and size of lesions)

  • Spontaneous metastasis models:

    • Orthotopic implantation of OR5B21-manipulated cells

    • Monitoring metastasis development over time

    • Quantification metrics: Incidence of metastasis, organ distribution, time to metastasis

  • Molecular imaging:

    • Bioluminescence imaging for tracking metastatic spread

    • PET/CT or MRI for anatomical and functional assessment

    • Quantification metrics: Signal intensity, volumetric measurements

Molecular signaling quantification:

  • STAT3/NF-κB/CEBPβ signaling axis assessment:

    • Phosphorylation status using phospho-specific antibodies

    • Nuclear translocation using cellular fractionation

    • Transcriptional activity using reporter assays

    • Quantification metrics: Phosphorylation ratio, nuclear/cytoplasmic distribution, luciferase activity

Research has demonstrated that OR5B21 knockdown significantly decreases the invasion and migration of breast cancer cells, as well as metastasis to different organs, especially the brain . Conversely, increasing OR5B21 transcript abundance enhances these metastatic properties. These established findings provide important benchmarks for validating new quantification approaches.

How does OR5B21 interact with other oncogenic pathways in breast cancer progression?

The interaction between OR5B21 and other oncogenic pathways represents a complex network of molecular cross-talk that collectively drives breast cancer progression and metastasis. While OR5B21 has been established as operating through the STAT3/NF-κB/CEBPβ signaling axis , emerging research suggests potential interactions with additional oncogenic pathways that merit further investigation.

Potential interactions with established breast cancer pathways:

  • Estrogen receptor (ER) signaling:

    • Investigation of potential cross-talk between OR5B21 and estrogen-responsive genes

    • Examination of OR5B21 expression patterns in ER-positive versus ER-negative tumors

    • Exploration of synergistic effects on metastatic potential

  • HER2/ErbB signaling:

    • Assessment of OR5B21 expression in HER2-amplified breast cancers

    • Evaluation of potential convergence on downstream PI3K/AKT and MAPK pathways

    • Investigation of combined targeting strategies

  • TGF-β pathway:

    • TGF-β is a major driver of EMT in breast cancer

    • Study of potential cooperation between OR5B21 and TGF-β in promoting EMT

    • Examination of shared transcriptional targets regulating invasion and migration

  • Wnt/β-catenin signaling:

    • Assessment of OR5B21's influence on β-catenin nuclear localization

    • Investigation of cooperative effects on stem cell-like properties

    • Evaluation of impact on metastatic colonization efficiency

Integration with inflammatory and immune pathways:

Given OR5B21's connection to NF-κB signaling , a key mediator of inflammatory responses, research should examine how OR5B21 might influence:

  • Tumor-associated inflammation

  • Immune cell recruitment and function in the tumor microenvironment

  • Cytokine and chemokine production affecting metastatic niche formation

Methodological approaches for pathway interaction studies:

  • Transcriptome and proteome analysis:

    • RNA-seq and proteomics comparing OR5B21-high versus OR5B21-low tumors

    • Pathway enrichment analysis to identify cooperating networks

    • Single-cell approaches to delineate cell population-specific effects

  • Epistasis experiments:

    • Combined knockdown/overexpression of OR5B21 with key components of other pathways

    • Rescue experiments to establish hierarchical relationships

    • Chemical inhibition of partner pathways in OR5B21-manipulated cells

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to identify direct binding partners

    • Proximity ligation assays to visualize interactions in situ

    • Interactome mapping using mass spectrometry-based approaches

Understanding these pathway interactions will provide a more comprehensive view of OR5B21's role in breast cancer progression and potentially reveal synthetic lethal relationships that could be exploited therapeutically.

What are the ligands for OR5B21 and how might they influence cancer pathophysiology?

The identification and characterization of ligands for OR5B21 represent a significant frontier in understanding this receptor's role in cancer pathophysiology. Unlike many olfactory receptors that have identified ligands, the specific molecules that activate OR5B21 remain largely uncharacterized. This knowledge gap presents both challenges and opportunities for researchers.

Current approaches for OR5B21 ligand identification:

  • High-throughput screening methodologies:

    • Functional screening using reporter assays in heterologous expression systems

    • Calcium imaging to detect activation upon ligand binding

    • BRET/FRET-based assays to detect conformational changes upon activation

  • In silico prediction approaches:

    • Structure-based virtual screening using homology models of OR5B21

    • Ligand-based approaches using known ligands of related olfactory receptors

    • Machine learning methods to predict potential activating compounds

  • Metabolomic profiling:

    • Comparison of metabolite profiles between metastatic and non-metastatic tissues

    • Identification of enriched molecules in microenvironments where OR5B21 is activated

    • Functional validation of candidate metabolites

Potential ligand sources in cancer pathophysiology:

  • Tumor microenvironment metabolites:

    • Products of altered cancer metabolism

    • Inflammatory mediators in the tumor microenvironment

    • Hypoxia-induced metabolic byproducts

  • Organ-specific factors:

    • Brain-specific lipids and neurotransmitters

    • Bone matrix components and osteoclast-derived factors

    • Lung-specific surfactants and respiratory epithelium secretions

  • Circulating factors:

    • Hormone-like compounds in circulation

    • Stress-induced endogenous molecules

    • Diet-derived compounds

Experimental considerations for ligand studies:

Olfactory perception and receptor activation are highly concentration-dependent, with different concentrations potentially leading to different responses. The M2OR database highlights that a molecule may not induce cellular response at low concentration but can become an agonist for multiple ORs at higher concentrations . Therefore, researchers should:

  • Include concentration-response relationships in all ligand studies

  • Report both screening concentrations and EC50 values

  • Consider stereochemistry, as certain ORs respond differently to enantiomers

  • Account for assay-dependent bias in interpreting OR responses

Potential impact of ligand identification:

Understanding OR5B21 ligands could lead to:

  • Development of receptor antagonists as potential metastasis inhibitors

  • Identification of biomarkers for metastatic risk assessment

  • Creation of "molecular decoys" to prevent receptor activation

  • Design of dietary or environmental interventions to modulate receptor activity

The functional validation of these ligands in the context of breast cancer metastasis would significantly advance our understanding of OR5B21's role and potentially reveal new therapeutic strategies.

What is the potential for developing therapeutic strategies targeting OR5B21?

The emerging understanding of OR5B21 as a driver of breast cancer metastasis positions this olfactory receptor as a promising target for therapeutic intervention. Developing effective strategies to inhibit OR5B21-mediated metastasis requires consideration of multiple approaches and methodological challenges.

Potential therapeutic approaches:

  • Direct receptor antagonism:

    • Small molecule antagonists that bind the receptor and prevent activation

    • Structure-based drug design using homology models of OR5B21

    • High-throughput screening of compound libraries to identify lead molecules

    • Optimization of antagonist properties for tissue penetration, particularly to the brain

  • Gene expression modulation:

    • siRNA/shRNA-based approaches for transient OR5B21 knockdown

    • Antisense oligonucleotides to reduce OR5B21 expression

    • CRISPR-based gene editing for permanent inactivation

    • Epigenetic modulators to silence OR5B21 transcription

  • Downstream pathway inhibition:

    • Targeting the STAT3/NF-κB/CEBPβ signaling axis

    • Combination approaches addressing multiple nodes in the pathway

    • EMT inhibitors to prevent the phenotypic transition promoted by OR5B21

  • Antibody-based approaches:

    • Development of antibodies targeting extracellular domains of OR5B21

    • Antibody-drug conjugates for targeted delivery of cytotoxic agents

    • Bispecific antibodies linking OR5B21 to immune effector cells

Methodological considerations for therapeutic development:

  • Target validation requirements:

    • Demonstration of OR5B21 dependency in patient-derived models

    • Confirmation of therapeutic index in normal versus cancer cells

    • Validation across multiple metastatic sites (brain, bone, lung)

  • Delivery challenges:

    • Blood-brain barrier penetration for targeting brain metastases

    • Targeted delivery to disseminated metastatic cells

    • Minimizing off-target effects in normal olfactory tissue

  • Combination strategy development:

    • Identification of synergistic therapies to enhance anti-metastatic effects

    • Integration with standard-of-care treatments for breast cancer

    • Temporal sequencing of OR5B21 targeting with other therapies

  • Biomarker development for patient selection:

    • Quantification of OR5B21 expression in primary tumors

    • Liquid biopsy approaches to detect OR5B21-expressing circulating tumor cells

    • Molecular imaging to identify OR5B21-positive metastatic lesions

Translational research roadmap:

Development StageKey ActivitiesMethodological Approaches
Target ValidationConfirm OR5B21 as driver in patient samplesImmunohistochemistry, RNA-seq, survival correlation
Hit IdentificationScreen for inhibitors of OR5B21 activityHigh-throughput screening, virtual screening
Lead OptimizationImprove potency, selectivity, and ADME propertiesMedicinal chemistry, structure-activity relationships
Preclinical ValidationTest efficacy in relevant metastasis modelsPDX models, organ-specific metastasis assays
Biomarker DevelopmentIdentify patient selection strategiesExpression patterns, activated pathway signatures
Clinical Trial DesignDevelop appropriate endpoints for metastasis preventionTime to metastasis, site-specific metastasis-free survival

Research has demonstrated that inhibiting OR5B21 decreased the spread of breast cancer cells to the brain and other organs, suggesting that using OR5B21 as a target for adjuvant therapy could help fulfill an unmet medical need by preventing breast cancer metastasis and thus prolonging patient survival . This promising foundation provides a strong rationale for therapeutic development efforts targeting this receptor.

What are the primary technical challenges in studying olfactory receptors in cancer contexts?

Investigating olfactory receptors like OR5B21 in cancer contexts presents unique technical challenges that researchers must navigate to generate reliable and meaningful data. These challenges span from fundamental receptor biology to complex cancer models and require specialized approaches to overcome.

Expression and detection challenges:

  • Low expression levels:

    • Olfactory receptors typically express at lower levels outside the nasal epithelium

    • Requires highly sensitive detection methods and appropriate signal amplification

    • Risk of false negatives in standard expression analyses

  • Antibody limitations:

    • High sequence homology between olfactory receptor family members complicates specific antibody development

    • Limited commercial availability of validated antibodies for many ORs including OR5B21

    • Need for rigorous validation protocols for any OR antibody used in research

  • Post-translational modifications:

    • Potential differences in protein processing between olfactory and extra-olfactory tissues

    • Impact on receptor localization, stability, and function

    • Technical difficulties in capturing these modifications

Functional assessment challenges:

  • Heterologous expression systems:

    • Olfactory receptors often show poor trafficking to the cell surface in standard cell lines

    • Requirement for specialized expression systems with chaperone proteins

    • Assay-dependent bias in receptor responses across different cell types

  • Ligand identification complexities:

    • Concentration-dependent activation patterns

    • Stereochemistry considerations in ligand interactions

    • Limited knowledge of endogenous ligands in cancer microenvironments

  • Signaling pathway variations:

    • Different G-protein coupling preferences in different cellular contexts

    • Alternative signaling mechanisms outside canonical olfactory transduction

    • Crosstalk with cancer-specific pathways

Cancer model-specific challenges:

  • Tumor heterogeneity:

    • Variable OR5B21 expression across different regions of a tumor

    • Clonal evolution affecting receptor expression during disease progression

    • Need for single-cell approaches to resolve cellular heterogeneity

  • Metastatic site accessibility:

    • Technical difficulties in studying brain metastases due to blood-brain barrier

    • Limited availability of matched primary and metastatic samples from the same patient

    • Complex microenvironmental factors that differ between metastatic sites

  • Translation between models:

    • Species differences in OR repertoires between human and animal models

    • Challenges in developing physiologically relevant in vitro systems

    • Functional variability of ORs in different model systems

Methodological strategies to address these challenges:

  • Use of specialized reporter systems with high sensitivity for OR activation

  • Implementation of CRISPR-based tagging approaches for endogenous receptor detection

  • Development of organotypic culture systems that maintain tissue-specific features

  • Application of patient-derived xenograft models to preserve tumor heterogeneity

  • Integration of multi-omics approaches to comprehensively characterize OR5B21 function

Addressing these technical challenges requires innovative methodological approaches and careful experimental design to elucidate the true significance of OR5B21 in breast cancer metastasis.

How should researchers control for specificity in OR5B21 functional studies?

Ensuring specificity in OR5B21 functional studies is critical for generating reliable and interpretable data. The complexity of olfactory receptor biology and potential for cross-reactivity necessitates rigorous control measures throughout experimental design, execution, and analysis.

Genetic manipulation controls:

  • Multiple knockdown approaches:

    • Use at least two different siRNA/shRNA sequences targeting different regions of OR5B21

    • Include scrambled/non-targeting controls with similar GC content

    • Rescue experiments with OR5B21 expression constructs resistant to knockdown

  • CRISPR-based strategies:

    • Employ multiple guide RNAs targeting different exons

    • Include control guide RNAs targeting non-essential genes

    • Generate and characterize multiple independent knockout clones

    • Perform off-target analysis and validation

  • Overexpression considerations:

    • Use inducible expression systems to control expression levels

    • Include proper empty vector controls

    • Compare multiple cell line models to control for cell-type specific effects

Receptor specificity controls:

  • Paralogue controls:

    • Parallel manipulation of closely related olfactory receptors

    • Comparison with other ORs expressed in breast cancer

    • Chimeric receptor approaches to map functional domains

  • Pharmacological validation:

    • Use of specific antagonists when available

    • Dose-response relationships to establish specificity

    • Competitive binding assays to confirm target engagement

  • Binding partner confirmation:

    • Co-immunoprecipitation with appropriate negative controls

    • Proximity ligation assays with specificity controls

    • Domain mapping to identify specific interaction regions

Pathway validation controls:

  • STAT3/NF-κB/CEBPβ signaling axis validation:

    • Parallel inhibition of individual pathway components

    • Constitutively active constructs for rescue experiments

    • Temporal analysis to establish causality in signaling events

  • EMT process verification:

    • Multiple EMT marker assessment (not relying on single markers)

    • Functional validation of EMT phenotypes (migration, invasion, etc.)

    • Reversibility testing through pathway inhibition

Experimental design considerations:

  • Blinding procedures:

    • Blinded analysis of functional outcomes to prevent bias

    • Third-party quantification of migration/invasion assays

    • Automated image analysis with predefined parameters

  • Replication strategies:

    • Technical replicates to control for procedural variability

    • Biological replicates using different cell passages

    • Independent validation in different laboratory settings

  • Statistical approaches:

    • Appropriate statistical tests with correction for multiple comparisons

    • Sample size determination based on power calculations

    • Reporting of all data including negative findings

By implementing these specificity controls, researchers can increase confidence that observed phenotypes are truly attributable to OR5B21 function rather than off-target effects or experimental artifacts. This methodological rigor is essential for advancing our understanding of OR5B21's role in breast cancer metastasis and developing targeted therapeutic strategies.

How does experimental design influence the interpretation of OR5B21's role in metastasis?

Model system selection impacts:

  • Cell line choice implications:

    • Molecular subtype differences (luminal, HER2+, triple-negative) affect OR5B21 function

    • Cell line-specific signaling architecture influences receptor coupling

    • Metastatic potential baseline varies across models

  • In vitro vs. in vivo discrepancies:

    • 2D culture systems may not recapitulate complex 3D environments

    • Artificial matrices differ from native tissue microenvironments

    • Animal models may not fully represent human disease progression

  • Clinical sample considerations:

    • Primary versus metastatic tissue differences

    • Treatment history effects on receptor expression and function

    • Inter-patient heterogeneity and genetic background influences

Temporal aspects of experimental design:

  • Acute versus chronic manipulation:

    • Transient knockdown may reveal different phenotypes than stable modification

    • Compensatory mechanisms may emerge in long-term studies

    • Temporal relationship between OR5B21 activity and metastatic progression

  • Metastatic cascade timing:

    • Early events (invasion, intravasation) versus late events (colonization, outgrowth)

    • Pre-metastatic niche formation timeline

    • Treatment window considerations for therapeutic targeting

Methodological variables affecting interpretation:

  • Assay sensitivity and dynamic range:

    • Detection thresholds for OR5B21 expression

    • Quantification limitations in functional assays

    • Resolution constraints in imaging metastatic lesions

  • Endpoint selection:

    • Surrogate markers versus direct metastasis measurement

    • Molecular versus phenotypic readouts

    • Single timepoint versus longitudinal assessment

Comparative analysis table of experimental approaches:

Experimental ApproachStrengthsLimitationsImpact on Interpretation
In vitro migration/invasionHigh throughput, controlled conditionsLacks tissue context, artificial matricesMay overestimate therapeutic potential
Organoid models3D architecture, patient-derivedLimited vascularization, immune componentsMore physiologically relevant but still simplified
Mouse xenograft modelsIn vivo metastasis, multiple organ sitesSpecies differences, immunocompromisedCloser to human disease but immunology aspects missing
Patient sample analysisDirect clinical relevanceSnapshot in time, limited manipulationStrong correlative data but causality challenging
Multi-omics integrationComprehensive molecular landscapeData complexity, causality unclearSystems-level understanding but requires validation

Interpretation framework recommendations:

  • Triangulation approach:

    • Combine multiple model systems with complementary strengths

    • Integrate in vitro mechanistic studies with in vivo validation

    • Correlate findings with patient data for clinical relevance

  • Pathway context consideration:

    • Assess OR5B21 in relation to established metastasis drivers

    • Map interactions with STAT3/NF-κB/CEBPβ signaling axis

    • Consider feedback mechanisms and pathway redundancy

  • Therapeutic implication assessment:

    • Distinguish between statistical and clinical significance

    • Evaluate potential for combination approaches

    • Consider patient stratification based on OR5B21 expression

Research has shown that while OR5B21 displays increased transcript abundance in all three major metastatic sites (brain, bone, and lung), it appears to have particularly strong effects on brain metastasis . This site-specific preference highlights the importance of considering organ-specific microenvironments when designing experiments and interpreting results regarding OR5B21's role in the metastatic process.

What are the most promising avenues for future OR5B21 research in oncology?

The emerging role of OR5B21 in breast cancer metastasis opens several promising research avenues that could significantly advance our understanding of cancer progression and lead to novel therapeutic approaches. Based on current knowledge and methodological capabilities, the following directions represent particularly high-value opportunities for future investigation:

  • Comprehensive ligand identification and characterization:

    • Systematic screening for endogenous OR5B21 ligands in normal and cancer tissues

    • Structure-activity relationship studies to develop potent and specific modulators

    • Investigation of ligand distribution in metastatic niches and circulation

  • Mechanistic dissection of the OR5B21 signaling network:

    • High-resolution mapping of the complete OR5B21-initiated signaling cascade

    • Identification of critical nodes and feedback mechanisms in the pathway

    • Exploration of tissue-specific signaling adaptations in different metastatic sites

  • Clinical correlation and biomarker development:

    • Large-scale analysis of OR5B21 expression across breast cancer subtypes and stages

    • Correlation of expression with metastatic patterns and patient outcomes

    • Development of OR5B21-based prognostic and predictive biomarkers

  • Therapeutic targeting strategies:

    • Design and screening of OR5B21 antagonists with favorable pharmacological properties

    • Development of nanoparticle-based delivery systems for OR5B21-directed therapeutics

    • Exploration of combination approaches with standard-of-care treatments

  • Expansion to other cancer types:

    • Investigation of OR5B21's role in additional malignancies beyond breast cancer

    • Comparative analysis of olfactory receptor functions across different tumor types

    • Exploration of common mechanisms in OR-mediated cancer progression

These research directions would benefit from emerging technologies and methodological approaches including:

  • Single-cell multi-omics to resolve cellular heterogeneity

  • CRISPR screening to identify synthetic lethal interactions

  • Patient-derived organoids and xenografts for translational validation

  • Advanced computational modeling of receptor-ligand interactions

  • Spatial transcriptomics to map OR5B21 expression in the tumor microenvironment

The most significant potential impact would likely come from efforts to identify and develop specific OR5B21 antagonists, as research has demonstrated that inhibiting this receptor decreased the spread of breast cancer cells to the brain and other organs . Such therapeutic development could help address the critical unmet medical need of preventing breast cancer metastasis, particularly to the brain, which represents a leading cause of mortality from the disease .

What reproducibility considerations should researchers address in OR5B21 studies?

Ensuring reproducibility in OR5B21 research is crucial for building a reliable knowledge foundation that can support translational applications. Researchers should implement comprehensive reproducibility practices that address the specific challenges of olfactory receptor studies in cancer contexts.

Experimental design considerations:

  • Power analysis and sample sizing:

    • Conduct appropriate statistical power calculations before experiments

    • Report sample size determination methods explicitly

    • Consider biological variability in cell lines and patient samples

  • Randomization and blinding:

    • Implement randomization procedures for sample allocation

    • Use blinded analysis for subjective measurements (e.g., histology, migration quantification)

    • Document randomization and blinding protocols in methods sections

  • Control selection and validation:

    • Include both positive and negative controls in all experiments

    • Validate knockdown/overexpression efficiency in each experimental batch

    • Use multiple control approaches (e.g., scrambled siRNA plus empty vector)

Methodological standardization:

  • Cell line authentication:

    • Regularly authenticate cell lines using STR profiling

    • Monitor for mycoplasma contamination

    • Document passage number and growth conditions

  • Reagent validation and reporting:

    • Provide complete details on antibodies (catalog number, lot, validation data)

    • Document source and purity of recombinant proteins

    • Verify plasmid constructs by sequencing before use

  • Protocol standardization:

    • Develop and follow detailed standard operating procedures

    • Document all deviations from established protocols

    • Consider inter-laboratory validation for key findings

Data reporting practices:

Reproducibility checklist for OR5B21 studies:

Reproducibility DomainKey ActionsImplementation Approach
Biological materialsAuthenticate cell lines, validate OR5B21 expressionSTR profiling, qPCR, western blotting
Experimental designPower analysis, randomization, blindingPre-registration, collaboration with statisticians
Reagent validationVerify antibody specificity, validate constructsMultiple validation methods, sequence verification
Protocol standardizationDetailed SOPs, consistent conditionsLab manual development, training programs
Data analysisTransparent statistics, complete reportingPre-specified analysis plans, open data sharing
Independent validationCross-laboratory verification, different modelsMulti-center collaborations, alternative approaches

OR5B21-specific reproducibility challenges:

  • Cellular context dependency:

    • Document cell line-specific features that may influence OR5B21 function

    • Address potential assay-dependent bias in receptor responses

    • Consider reproducibility across different experimental systems

  • Concentration considerations:

    • Report exact concentrations for all ligands and modulators

    • Document concentration-response relationships

    • Consider variability in effective concentrations across systems

  • Technical detection limitations:

    • Address sensitivity thresholds in expression analyses

    • Document normalization approaches for comparing across samples

    • Consider alternative detection methods for validation

By implementing these reproducibility practices, researchers studying OR5B21 can build a more robust foundation of knowledge that advances our understanding of this receptor's role in breast cancer metastasis and supports the development of targeted therapeutic strategies.

How can researchers effectively translate OR5B21 findings from bench to bedside?

Translating OR5B21 findings from laboratory discoveries to clinical applications requires a strategic approach that bridges fundamental research with therapeutic development. An effective translational pathway should address scientific, regulatory, and clinical implementation challenges specific to this novel oncogenic target.

Preclinical validation requirements:

  • Target validation in clinically relevant models:

    • Patient-derived xenografts representing different breast cancer subtypes

    • Humanized mouse models to assess immune system interactions

    • Ex vivo culture of patient samples with OR5B21 modulation

  • Therapeutic candidate development:

    • Structure-based design of OR5B21 antagonists

    • Multiple chemical scaffolds to diversify development risk

    • Early ADME-Tox profiling to identify promising candidates

  • Efficacy demonstration in metastasis models:

    • Prevention of metastasis formation (adjuvant setting)

    • Treatment of established metastases (metastatic setting)

    • Combination studies with standard-of-care therapies

Biomarker development pathway:

  • Patient stratification markers:

    • OR5B21 expression level assessment methods

    • Downstream pathway activation signatures

    • Predictive markers of response to OR5B21-targeted therapy

  • Pharmacodynamic markers:

    • Direct target engagement measures

    • Pathway inhibition biomarkers

    • EMT process reversal indicators

  • Clinical implementation approaches:

    • Tissue-based assays for primary tumor assessment

    • Liquid biopsy methods for monitoring during treatment

    • Imaging approaches for metastatic site evaluation

Clinical development strategy:

Translational research roadmap:

Translational PhaseKey ObjectivesMethodological Approaches
Target ValidationConfirm OR5B21 driver role in patient cohortsTissue microarrays, retrospective analysis, meta-analysis
Therapeutic DevelopmentIdentify and optimize OR5B21 antagonistsMedicinal chemistry, structure-activity relationships
Preclinical Proof-of-ConceptDemonstrate efficacy in relevant modelsPDX models, metastasis assays, combination studies
Biomarker DevelopmentEstablish patient selection and response markersExpression analysis, functional assays, imaging
IND-Enabling StudiesComplete toxicology and formulation workGLP toxicology, pharmaceutical development
Early Clinical TrialsEstablish safety and preliminary efficacyPhase 1/2 trials in metastatic and adjuvant settings

Addressing translational challenges:

  • Target novelty considerations:

    • Education of clinicians about olfactory receptors in cancer

    • Clear mechanistic narrative connecting OR5B21 to established cancer biology

    • Strong preclinical package demonstrating clinical relevance

  • Metastasis prevention challenges:

    • Extended follow-up periods required for endpoints

    • Large sample sizes needed for statistical power

    • Complex patient stratification to enrich for metastatic risk

  • Brain metastasis-specific considerations:

    • Blood-brain barrier penetration for therapeutic agents

    • Neurological monitoring during clinical development

    • Specialized imaging protocols for brain metastasis assessment

The translational potential of OR5B21 research is particularly compelling given research findings that inhibiting this receptor decreased breast cancer metastasis to the brain and other organs . With breast cancer brain metastasis being a leading cause of mortality from the disease , successful translation could address a critical unmet medical need by providing new approaches to prevent or treat metastatic spread, ultimately improving patient outcomes and survival.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.