Recombinant Human Olfactory receptor 5B2 (OR5B2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
OR5B2; Olfactory receptor 5B2; OST073; Olfactory receptor OR11-240
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR5B2
Target Protein Sequence
MENCTEVTKFILLGLTSVPELQIPLFILFTFIYLLTLCGNLGMMLLILMDSCLHTPMYFF LSNLSLVDFGYSSAVTPKVMAGFLRGDKVISYNACAVQMFFFVALATVENYLLASMAYDR YAAVCKPLHYTTTMTASVGACLALGSYVCGFLNASFHIGGIFSLSFCKSNLVHHFFCDVP AVMALSCSDKHTSEVILVFMSSFNIFFVLLVIFISYLFIFITILKMHSAKGHQKALSTCA SHFTAVSVFYGTVIFIYLQPSSSHSMDTDKMASVFYAMIIPMLNPVVYSLRNREVQNAFK KVLRRQKFL
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8323

KEGG: hsa:390190

STRING: 9606.ENSP00000303076

UniGene: Hs.553753

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of human OR5B2?

Human OR5B2 (olfactory receptor family 5 subfamily B member 2) is a G-protein-coupled receptor (GPCR) characterized by a 7-transmembrane domain structure. Like other olfactory receptors, it originates from a single coding-exon gene and shares structural similarities with neurotransmitter and hormone receptors. OR5B2 belongs to the largest gene family in the human genome - the olfactory receptor family - and plays a crucial role in the recognition and G protein-mediated transduction of odorant signals .

What experimental systems are recommended for studying OR5B2 function?

Multiple experimental systems can be employed to study OR5B2 function, including:

  • Native Olfactory Sensory Neurons (OSNs): These provide a physiologically relevant system but are technically challenging to work with.

  • Heterologous Expression Systems: Most commonly used are:

    • HEK293 cells: Standard mammalian expression system

    • Hana3A cells: Modified HEK293 derivative expressing chaperon proteins (RTP1/RTP2), olfactory G-proteins, and rho tag

    • LNCaP cells: Human prostate carcinoma cell line that has shown success in identifying ligands not recognized in HEK293 cells

When selecting an expression system, researchers should consider that different systems may yield varying results for the same OR-ligand interactions, creating an "assay-dependent bias." Approximately 41% of published bioassay results for ORs come from luciferase assays using the Hana3A cell line .

How can I validate the successful expression of recombinant OR5B2?

Successful expression of recombinant OR5B2 can be validated through:

  • Western Blotting: Using antibodies specific to OR5B2 or to an epitope tag (if the recombinant protein is tagged)

  • Immunofluorescence: To confirm appropriate membrane localization

  • Functional Assays: Such as calcium imaging or cAMP accumulation assays to test receptor responsiveness to known odorants

  • Molecular Dynamics Simulations: To validate the predicted structural model of the receptor and assess stability in a membrane environment

Remember that the presence of chaperon proteins like RTP1 or RTP2 may significantly improve surface expression of recombinant ORs.

What are the optimal assay methodologies for measuring OR5B2 activation?

Several methodologies can be employed to measure OR5B2 activation, each with specific advantages:

  • Luciferase Reporter Assays: These monitor activation of signaling pathways downstream of OR activation, typically using a cAMP-responsive element (CRE) driving luciferase expression. This approach allows high-throughput screening but provides an indirect measure of receptor activation.

  • Calcium Imaging: Measures intracellular calcium flux following receptor activation. This can be performed using calcium-sensitive dyes (Fluo-4) or genetically encoded calcium indicators (GCaMPs).

  • Electrophysiology:

    • Whole-cell recordings: Provide information on current amplitude, kinetics, and ion selectivity

    • Outside-out patch recordings: Allow single-channel analysis, revealing conductance and gating properties

  • BRET/FRET Assays: These can measure conformational changes in the receptor or interactions with signaling partners.

For quantitative analysis of odorant-evoked responses, consider using an activity index formula: (−log(EC₅₀) × max ΔF/F), which captures both apparent affinity and maximal efficacy of an odorant .

How should odorant concentration be controlled in OR5B2 experiments?

Odorant concentration is a critical parameter that significantly influences OR5B2 activation and experimental outcomes:

  • Concentration Range: Test a broad concentration range (typically 10⁻⁸ to 10⁻³ M) to establish dose-response relationships.

  • EC₅₀ Determination: Calculate the concentration at which half-maximal response is achieved for accurate comparisons between ligands.

  • Threshold Determination: Establish the minimum concentration required for detectable activation.

  • Cross-Contamination Prevention: Use sealed containers for odorant storage and preparation to prevent volatile cross-contamination.

  • Vehicle Controls: Include appropriate solvent controls (typically DMSO or ethanol) to account for potential vehicle effects.

Remember that concentration-dependent effects are significant - a molecule may not induce cellular response at low concentration but might become an agonist for multiple ORs at higher concentrations .

What expression vectors are most effective for recombinant OR5B2 studies?

When selecting expression vectors for OR5B2 studies, consider:

  • Promoter Strength: CMV promoter provides strong expression in mammalian cells, while weaker promoters may be preferable if OR5B2 overexpression causes toxicity.

  • Tags and Fusion Proteins:

    • N-terminal signal sequences (e.g., from rhodopsin) can enhance membrane targeting

    • C-terminal epitope tags (e.g., FLAG, HA) facilitate detection without interfering with ligand binding

    • Fluorescent protein fusions allow visualization but may affect function

  • Co-expression Constructs: Vectors enabling co-expression of OR5B2 with RTP1/2 chaperon proteins and Golf can significantly improve functional expression.

  • Inducible Systems: Tet-On/Off systems allow controlled expression timing, which can improve functional studies if constitutive expression causes toxicity.

How do sodium ions influence OR5B2 structure and function?

Sodium ions play a crucial role in stabilizing the inactive state of OR5B2 and potentially other olfactory receptors:

  • Sodium Binding Pocket: Located near conserved acidic residues, particularly at positions equivalent to D2.50 and E3.39 in the generic GPCR numbering system.

  • Conformational Stability: Molecular dynamics simulations demonstrate that sodium is required to stabilize the inactive conformation of the receptor.

  • Conservation Pattern: The acidic residues forming the sodium binding site are highly conserved across human ORs, suggesting this is a general feature of this receptor family.

  • Structural Implications: When designing experimental protocols for structural studies, researchers should consider sodium concentration in buffers, particularly for studies aimed at capturing the inactive state of the receptor .

  • Physiological Relevance: Under physiological conditions, the sodium gradient across the cell membrane may contribute to the regulation of OR activation threshold.

How can machine learning approaches enhance OR5B2 research?

Machine learning (ML) can significantly advance OR5B2 research through:

  • Structure Prediction: ML-based algorithms like AlphaFold2 can predict the 3D structure of OR5B2, providing templates for further refinement through molecular dynamics simulations.

  • Refinement Protocol: A recommended protocol includes:

    • Initial structure prediction using ML algorithms

    • Embedding in a lipid bilayer

    • Molecular dynamics simulations to refine and validate the model

    • Assessment of sodium binding and its effects on structure stability

  • Ligand Prediction: ML can analyze physicochemical parameters of known ligands to predict novel compounds likely to activate OR5B2.

  • Data Integration: ML models can integrate diverse experimental datasets (from different assay types and laboratories) to identify patterns not evident in individual experiments.

  • Response Pattern Analysis: Neural networks can be trained to recognize complex activation patterns across multiple ORs in response to various odorants.

How should researchers address contradictory data in OR5B2 binding studies?

Contradictory data is common in OR-ligand interaction studies and should be approached methodically:

  • Experimental Variation Analysis:

    • Compare assay types used (luciferase, calcium imaging, electrophysiology)

    • Evaluate expression systems (HEK293, Hana3A, LNCaP cells)

    • Assess concentration ranges tested

  • Stereochemistry Consideration: Different stereoisomers of the same compound may elicit different responses from OR5B2, so exact stereochemical information should be carefully documented and compared .

  • Data Integration Strategy:

    • Evaluate all contradictory findings rather than dismissing certain datasets

    • Look for subtle nuances that might explain apparent contradictions

    • Consider each dataset as representing different facets of a complex biological reality

  • Consensus Building:

    • Use a data agnostic mindset, acknowledging that all data sources have limitations

    • Develop confidence scores for findings based on reproducibility across different experimental platforms

    • Consider meta-analysis approaches to identify trends across multiple studies

  • Reporting Guidelines: When publishing results, transparently report all experimental conditions, including negative or contradictory findings, to facilitate more comprehensive understanding.

How does OR5B2 compare to other human olfactory receptors in terms of ligand specificity?

OR5B2 belongs to the broader family of human olfactory receptors, which display varying degrees of ligand specificity:

  • Specificity Spectrum: Human ORs exist on a spectrum from highly selective (responding to few molecules) to broadly tuned (responding to many diverse molecules). Understanding where OR5B2 falls on this spectrum requires systematic testing against odorant panels.

  • Molecular Receptive Field: This concept describes the range of chemical structures recognized by a given OR. The molecular receptive field can be mapped by testing structurally diverse odorants and analyzing:

    • Carbon chain length preferences

    • Functional group requirements

    • Stereochemical constraints

    • Molecular flexibility tolerance

  • Comparative Analysis Framework: When comparing OR5B2 to other ORs, researchers should consider:

    • Percentage of tested compounds that elicit responses

    • Distribution of response intensities

    • Chemical diversity of activating compounds

    • Concentration-response relationships

  • Phylogenetic Context: OR5B2's ligand specificity should be interpreted in the context of its evolutionary relationships with other ORs in subfamily 5B and the broader OR family .

What structural features differentiate OR5B2 from other members of the OR5 subfamily?

Key structural features differentiating OR5B2 include:

  • Binding Pocket Composition: The amino acid residues lining the binding pocket determine ligand specificity:

    • Transmembrane domains 3, 5, and 6 typically contribute most significantly to the binding pocket

    • Specific residue positions equivalent to R262^6.59 and S258^6.55 may be particularly important for hydrogen bonding with ligands

  • Extracellular Loop Variations:

    • Extracellular loop 2 (ECL2) often shows high variability between OR subfamily members

    • These loops influence ligand access to the binding pocket and may contribute to selectivity filters

  • Conserved Motifs: Certain sequence motifs are highly conserved across all ORs but may have subtle variations in OR5B2 that affect function:

    • DRY motif at the intracellular end of TM3

    • NPXXY motif in TM7

    • OR-specific motifs that differ from other GPCR families

  • Sodium Binding Site: While the presence of a sodium binding site involving conserved acidic residues is likely a general feature of ORs, specific arrangement of these residues in OR5B2 may influence its activation properties .

What physicochemical descriptors best predict potential OR5B2 ligands?

When predicting potential ligands for OR5B2, multiple regression analysis suggests focusing on these key physicochemical properties:

  • Primary Predictive Descriptors:

    • Low polar surface area

    • Low water solubility

    • Appropriate lipophilicity (LogP)

    • Molecular volume compatible with binding pocket dimensions

  • Secondary Structural Features:

    • Presence of hydrogen bond donors/acceptors that can interact with key binding pocket residues

    • Molecular flexibility (rotatable bonds)

    • Ring structures and aromaticity

    • Functional group positioning

  • Activity Index Calculation: For comprehensive evaluation of potential ligands, calculate an activity index using the formula:
    Activity Index = −log(EC₅₀) × maximal efficacy
    This accounts for both binding affinity and receptor activation efficiency .

  • Limitation Awareness: No single descriptor strongly predicts agonism, emphasizing the need for multiparametric approaches to ligand prediction.

How can researchers distinguish between specific and non-specific interactions in OR5B2 binding studies?

Distinguishing specific from non-specific interactions requires rigorous controls and methodological considerations:

  • Concentration-Response Relationships:

    • Specific interactions typically show saturable concentration-response curves

    • Calculate EC₅₀ values to quantify apparent affinity

    • Non-specific effects often show linear or non-saturable responses

  • Competitive Binding Assays:

    • Test whether known ligands can compete with test compounds

    • Use structurally related inactive compounds as negative controls

  • Mutagenesis Validation:

    • Introduce point mutations in predicted binding pocket residues

    • Specific interactions will be disrupted by targeted mutations

    • Non-specific effects typically persist despite binding pocket alterations

  • Cross-Receptor Selectivity:

    • Test compounds against related and unrelated ORs

    • Highly promiscuous activation across diverse receptors suggests potential non-specific effects

    • Compare activation profiles to those of known non-specific GPCR activators

  • Orthogonal Assay Validation:

    • Confirm findings using multiple assay technologies (e.g., calcium imaging, cAMP accumulation, receptor internalization)

    • Specific interactions should be detectable across different readout systems

What are the most promising approaches for resolving the high-resolution structure of OR5B2?

Obtaining high-resolution structures of ORs represents a significant challenge. The most promising approaches include:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Recent successes with other GPCRs suggest this is currently the most viable method

    • Requires stabilization of the receptor, potentially through:

      • Fusion partners (e.g., T4 lysozyme, BRIL)

      • Conformational stabilizing antibodies or nanobodies

      • Ligand complexes to stabilize specific conformational states

  • X-ray Crystallography with Advanced Stabilization:

    • Lipidic cubic phase crystallization

    • Thermostabilizing mutations

    • Antibody fragment (Fab) co-crystallization

  • Integrated Approaches:

    • Combine machine learning structure prediction with experimental validation

    • Use molecular dynamics simulations to refine predicted structures

    • Validate with biochemical and biophysical techniques (e.g., cysteine accessibility scanning, HDX-MS)

  • Structure in Native Environment:

    • Single-particle analysis of OR5B2 in nanodiscs or native membranes

    • Advanced tomographic approaches for in situ structural determination

How might contradictory data in OR5B2 research lead to new discoveries?

Contradictory data should be viewed as an opportunity for deeper understanding rather than a problem to resolve:

  • Revealing Receptor Plasticity:

    • Contradictory binding data may reflect the receptor's ability to adopt multiple conformations

    • Different experimental systems may favor distinct conformational states

    • Analysis of these contradictions could reveal unappreciated conformational dynamics

  • Discovering Biased Signaling:

    • Contradictory functional data may indicate biased signaling through different G-protein subtypes or β-arrestin pathways

    • Different assay systems may be differentially sensitive to specific signaling outcomes

    • Systematic exploration of these discrepancies could reveal signaling complexity

  • Uncovering Environmental Sensitivities:

    • Contradictions may reveal sensitivity to specific experimental conditions:

      • Membrane composition effects

      • Co-receptor or accessory protein requirements

      • Ion concentration dependencies

  • Nuanced Understanding Development:

    • Embrace the complexity revealed by contradictory data

    • Develop more sophisticated models that account for the multifaceted nature of receptor function

    • Consider that the "true" behavior of the receptor may encompass seemingly contradictory observations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.