Recombinant Human Olfactory receptor 5H14 (OR5H14)

Shipped with Ice Packs
In Stock

Description

Production and Expression Systems

OR5H14 is produced via recombinant DNA technology in various systems, each with distinct advantages:

Expression SystemAdvantagesLimitationsSources
E. coliHigh yield, low costNo post-translational modifications
Mammalian CellsProper folding and membrane integrationHigher cost, complex handling
Insect CellsNative-like glycosylationTime-intensive culturing
Cell-Free SystemsRapid production, tag flexibilityLimited functional testing

Purification methods include affinity chromatography (e.g., Strep-tag or His-tag) , yielding proteins with >85–90% purity (SDS-PAGE) .

Research Applications

Recombinant OR5H14 is primarily used in structural and functional studies:

  • Structural Analysis:

    • SDS-PAGE/Western Blot: Validates protein integrity and tag presence .

    • ELISA: Detects receptor-ligand interactions (if ligands are identified) .

  • Functional Studies:

    • Limited data due to uncharacterized ligands, but theoretical applications include GPCR signaling assays and membrane stabilization in nanodiscs or liposomes .

Challenges and Future Directions

  • Ligand Identification: Current lack of known ligands limits functional studies .

  • Membrane Stability: GPCRs are notoriously difficult to stabilize; advanced techniques like SMALPs or nanodiscs may improve solubility .

  • High-Throughput Screening: Cell-free expression systems (e.g., AliCE®) enable rapid production for ligand discovery .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
OR5H14; Olfactory receptor 5H14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
OR5H14
Target Protein Sequence
MEEENATLLTEFVLTGFLYQPQWKIPLFLAFLVIYLITIMGNLGLIAVIWKDPHLHIPMY LLLGNLAFVDALLSSSVTLKMLINFLAKSKMISLSECKIQLFSFAISVTTECFLLATMAY DRYVAICKPLLYPAIMTNGLCIRLLILSYVGGLLHALIHEGFLFRLTFCNSNIIQHFYCD IIPLLKISYTDSSINFLMVFIFAGSIQVFTIGTVLISYIFVLYTILKKKSVKGMRKAFST CGAHLLSVSLYYGPLAFMYMGSASPQADDQDMMESLFYTVIVPLLNPMIYSLRNKQVIAS FTKMFKRNDV
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 31286

KEGG: hsa:403273

STRING: 9606.ENSP00000401706

UniGene: Hs.554714

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR5H14 and how does it function within the human olfactory system?

OR5H14 (Olfactory Receptor 5H14) is one of approximately 400 different olfactory receptors found in humans. Like other olfactory receptors, OR5H14 belongs to the G protein-coupled receptor (GPCR) superfamily and is expressed in olfactory sensory neurons in the nasal epithelium. When activated by specific odorant molecules, these receptors trigger an electrical signal that stimulates olfactory neurons, which then transmit the signal to the brain for interpretation as a scent .

The human nose contains a diverse array of olfactory receptors that, through various combinations, can detect between ten thousand and potentially up to one trillion different odors . OR5H14 contributes to this remarkable sensory capacity by recognizing specific molecular patterns in odorants.

What expression systems are most effective for producing recombinant olfactory receptors?

Mammalian cell expression systems have proven most effective for producing functional recombinant olfactory receptors. Based on research with other olfactory receptors like hOR17-4, stable tetracycline-inducible human embryonic kidney cell lines (HEK293S) have demonstrated successful expression of these challenging membrane proteins .

The key advantages of mammalian expression systems include:

  • Proper post-translational modifications essential for receptor function

  • Appropriate cellular machinery for membrane protein folding

  • Ability to create stable inducible cell lines for on-demand protein production

For example, using tetracycline-inducible HEK293S cells, researchers achieved expression levels of approximately 30 μg of olfactory receptor per 150 mm tissue culture plate when inducing with a combination of tetracycline and sodium butyrate .

What are the optimal storage conditions for recombinant OR5H14?

Recombinant OR5H14 requires careful storage to maintain stability and functionality. According to product specifications, the shelf life varies based on physical state and storage conditions :

FormStorage TemperatureShelf Life
Liquid-20°C/-80°C6 months
Lyophilized-20°C/-80°C12 months

For working aliquots, storage at 4°C is recommended for up to one week, and repeated freeze-thaw cycles should be avoided to preserve protein integrity . When reconstituting lyophilized protein, it should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C .

What strategies overcome the challenges of producing high-purity olfactory receptors for structural studies?

Producing high-purity olfactory receptors presents significant challenges due to their hydrophobic nature as membrane proteins. Based on successful approaches with other olfactory receptors, a multi-faceted strategy is recommended:

  • Gene optimization: Synthetic gene construction using PCR-based methods enables codon optimization for the expression system and facilitates the addition of affinity tags for detection and purification . For instance, the attachment of a 9-residue bovine rhodopsin affinity tag (rho1D4) has proven effective for olfactory receptor purification .

  • Detergent selection: Systematic detergent screening is crucial to identify optimal solubilization agents. For hOR17-4, zwitterionic detergents, particularly fos-choline-14 (N-tetradecylphosphocholine), demonstrated superior capability for receptor extraction and solubilization .

  • Two-step purification process: A combination of immunoaffinity chromatography (using the affinity tag) followed by size exclusion chromatography has been successfully employed to achieve >90% purity of olfactory receptors . This approach enabled researchers to obtain 0.13 milligrams of purified olfactory receptor monomer from their expression system .

How can oligomeric states of recombinant olfactory receptors be characterized and controlled?

Olfactory receptors can exist in various oligomeric states, which may affect their functionality and structural properties. SDS-PAGE analysis of purified recombinant olfactory receptors has revealed the presence of monomeric, dimeric, and higher molecular weight oligomeric species .

To characterize and control oligomeric states:

  • Analytical techniques: Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) can be used to determine the molecular weight and oligomeric state of the purified receptor in detergent solution.

  • Stabilizing conditions: Screening different buffer compositions, detergents, and lipids can help identify conditions that stabilize specific oligomeric states. For example, the addition of specific lipids or cholesterol may influence receptor oligomerization.

  • Crosslinking studies: Chemical crosslinking followed by mass spectrometry can provide insights into the interfaces involved in receptor oligomerization.

For structural studies focusing on monomeric receptors, size exclusion chromatography can be used to isolate the monomeric fraction, as demonstrated in the purification of hOR17-4 .

What functional assays can validate the activity of purified recombinant OR5H14?

Validating the functionality of purified olfactory receptors is essential for ensuring their biological relevance. Several complementary approaches can be employed:

  • Ligand binding assays: Fluorescence-based or radioligand binding assays can measure the direct interaction between the receptor and its odorant ligands. Saturation binding experiments can determine the affinity (Kd) and maximum binding capacity (Bmax).

  • Reconstitution into liposomes or nanodiscs: Purified OR5H14 can be incorporated into artificial membrane systems to better mimic its native environment. These reconstituted systems can then be used for functional studies.

  • G protein coupling assays: Since olfactory receptors are GPCRs, assays measuring G protein activation, such as [35S]GTPγS binding or bioluminescence resonance energy transfer (BRET), can assess receptor functionality.

  • Surface plasmon resonance (SPR): This technique can characterize the kinetics of ligand binding to immobilized receptors, providing information on association and dissociation rates.

  • Calcium imaging or cAMP assays: When expressed in appropriate cell lines, olfactory receptor activation can be monitored through downstream signaling events such as changes in intracellular calcium or cAMP levels.

What biophysical and structural methods are most suitable for characterizing OR5H14?

Understanding the structural features of olfactory receptors is crucial for elucidating their function. Several biophysical methods can be applied to purified OR5H14:

  • Circular dichroism (CD) spectroscopy: This technique can assess the secondary structure content (α-helices, β-sheets) of the purified receptor and monitor structural changes upon ligand binding.

  • Fourier-transform infrared (FTIR) spectroscopy: FTIR provides complementary information on protein secondary structure and can be performed in various membrane mimetics.

  • Nuclear magnetic resonance (NMR) spectroscopy: For specific isotopically labeled residues or domains, NMR can provide site-specific structural and dynamic information.

  • X-ray crystallography: With sufficient quantities of highly purified, homogeneous receptor, crystallization trials can be attempted, potentially leading to high-resolution structural information. The purification methods developed for hOR17-4 were specifically designed to produce material suitable for crystallization trials .

  • Cryo-electron microscopy (cryo-EM): Recent advances in cryo-EM have made it possible to determine structures of smaller membrane proteins, including GPCRs, making this an increasingly viable option for olfactory receptors.

How can computational approaches complement experimental studies of OR5H14?

Computational methods offer powerful tools to enhance experimental research on olfactory receptors:

  • Homology modeling: Since experimental structures of most olfactory receptors are not yet available, homology models based on related GPCRs can provide insights into the three-dimensional arrangement of OR5H14.

  • Molecular dynamics simulations: These can reveal dynamic behaviors of the receptor in a membrane environment and predict conformational changes associated with activation.

  • Virtual screening: Computational docking of odorant molecules can predict potential ligands and binding modes, guiding experimental validation.

  • Machine learning approaches: These can be used to analyze large datasets of receptor-ligand interactions and predict new relationships.

  • Systems biology modeling: Integration of receptor-level data into broader olfactory signaling networks can provide context for understanding receptor function.

What are the key quality control parameters for recombinant OR5H14 production?

Ensuring consistent quality of recombinant OR5H14 requires rigorous quality control measures:

  • Purity assessment: SDS-PAGE analysis should confirm purity >85% as specified for commercial recombinant OR5H14 . Higher purity (>90%) may be required for certain applications such as structural studies.

  • Identity verification: Western blotting with specific antibodies and mass spectrometry analysis can confirm the identity of the purified protein.

  • Functional integrity: Ligand binding assays should demonstrate that the purified receptor retains its ability to recognize specific odorants.

  • Homogeneity assessment: Size exclusion chromatography and dynamic light scattering can evaluate the monodispersity of the purified receptor, which is crucial for structural studies.

  • Stability monitoring: Thermal shift assays can assess the stability of the receptor under various conditions and in the presence of different ligands.

How do expression and purification protocols need to be modified when working with different olfactory receptors?

While general principles apply across olfactory receptors, specific modifications may be necessary when adapting protocols from one receptor (like hOR17-4) to another (like OR5H14):

  • Codon optimization: The codon usage should be optimized for the specific receptor sequence and expression system to maximize protein production .

  • Affinity tag selection: While the 9-residue rhodopsin tag (TETSQVAPA) has proven effective for some olfactory receptors , different tags might be optimal for others depending on their C-terminal structure and the available purification resources.

  • Detergent screening: Each receptor may have different optimal detergents for solubilization and purification. A systematic screening of various detergents is recommended when working with a new receptor .

  • Expression conditions: The optimal induction conditions (inducer concentration, temperature, duration) may vary between different receptors and should be empirically determined.

  • Purification strategy: While the two-step purification process (immunoaffinity followed by size exclusion chromatography) has proven successful for hOR17-4 , additional or alternative steps might be necessary for other receptors depending on their specific properties.

What are the prospects for determining the three-dimensional structure of OR5H14?

Recent advances in membrane protein structural biology offer promising approaches for determining the structure of olfactory receptors like OR5H14:

  • Cryo-EM advancements: Improvements in detectors, sample preparation, and image processing have enabled structure determination of increasingly smaller membrane proteins.

  • Stabilization strategies: Development of conformational stabilization methods, such as thermostabilizing mutations or antibody fragments, could facilitate crystallization or cryo-EM studies of olfactory receptors.

  • Expression optimization: Building upon established protocols for recombinant expression , further refinements could increase yield and purity, providing sufficient material for structural studies.

  • Alternative approaches: Emerging techniques such as micro-electron diffraction (microED) might offer new opportunities for structural determination of challenging membrane proteins like olfactory receptors.

How might understanding OR5H14 contribute to developments in olfactory biosensors?

The purification and characterization of olfactory receptors open avenues for developing novel biosensing technologies:

  • Bionic sensing devices: Purified olfactory receptors like hOR17-4 have been proposed as components for fabricating olfactory receptor-based bionic sensing devices , suggesting similar applications for OR5H14.

  • Immobilization strategies: Development of methods to immobilize functional olfactory receptors on various surfaces while maintaining their activity is crucial for biosensor applications.

  • Signal transduction mechanisms: Engineering artificial signal transduction systems that can convert olfactory receptor activation into measurable outputs (electrical, optical, etc.) represents a key challenge in biosensor development.

  • Receptor arrays: Creating arrays of different olfactory receptors, potentially including OR5H14, could enable pattern recognition approaches to odor detection, mimicking the combinatorial coding used by the human olfactory system .

What strategies address poor expression of recombinant OR5H14?

Low expression yields can significantly hamper research progress. Several approaches can help overcome this challenge:

How can aggregation and misfolding of recombinant olfactory receptors be minimized?

Membrane proteins like olfactory receptors are prone to aggregation and misfolding. To minimize these issues:

  • Optimize solubilization conditions: Systematic screening of detergents, as demonstrated for hOR17-4 where fos-choline-14 was identified as optimal , is essential for each receptor.

  • Include stabilizing agents: Addition of specific lipids, cholesterol, or other stabilizing compounds during solubilization and purification can help maintain proper folding.

  • Control temperature: Performing extraction and purification steps at reduced temperatures (4°C) can help minimize aggregation.

  • Add specific ligands: Including known receptor ligands during purification can stabilize native conformations.

  • Utilize protein engineering: Introduction of stabilizing mutations or removal of aggregation-prone regions, if they don't affect function, can improve receptor stability.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.