Recombinant Human Olfactory receptor 5K1 (OR5K1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of OR5K1

OR5K1 is encoded by the OR5K1 gene located on human chromosome 3 . It belongs to the class A GPCR subfamily and features a canonical 7-transmembrane domain structure common to olfactory receptors . Recombinant OR5K1 is produced by cloning the OR5K1 gene into expression systems (e.g., HEK293 cells) for functional studies .

Agonist Profile:

Compound NameEC₅₀ (μM)Role
2,3-diethyl-5-methylpyrazine10.29Key food odorant
2-ethyl-3,6-dimethylpyrazine14.85Food aroma/semiochemical
Trimethylpyrazine21.18Signaling molecule
4-methoxy-2,5-dimethylfuranone32.40Food flavoring agent
Data sourced from functional assays .

OR5K1 responds selectively to 18 pyrazines and structurally related compounds, with no cross-reactivity to non-pyrazine odorants .

Evolutionary and Comparative Insights

Orthologs of OR5K1 in domesticated animals (e.g., mice, cows) exhibit similar pyrazine activation patterns, suggesting co-evolution under domestication pressures . For example:

  • Mouse OR5K1: 89% sequence identity to human OR5K1, with comparable EC₅₀ values for pyrazines .

  • Domesticated species: Shared ligand specificity implies conserved roles in food selection and communication .

Research Tools and Assays

Recombinant OR5K1 is utilized in high-throughput screening and structural studies:

  • ELISA Kits: Detect OR5K1 in plasma, serum, and tissue homogenates with a sensitivity of 1.0 pg/mL .

  • Cellular Assays: Luminescence-based cAMP measurements confirm receptor activation .

  • Computational Modeling: AlphaFold-predicted structures and homology models guide ligand-docking studies .

Applications in Food Science and Beyond

  • Food Aroma Analysis: OR5K1 helps identify pyrazines responsible for roasted or heated food odors .

  • Olfactory Signaling: Investigates interspecies communication via semiochemicals .

  • Drug Discovery: Structural models aid in designing modulators for olfactory-related disorders .

Challenges and Future Directions

  • Structural Limitations: No experimental 3D structures exist; reliance on AlphaFold and homology models .

  • Ligand Diversity: Only ~5% of human olfactory receptors have characterized ligands .

  • Mutational Studies: Further exploration of residues like L104 and L255 could refine agonist specificity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
OR5K1; Olfactory receptor 5K1; HTPCRX10; Olfactory receptor OR3-8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR5K1
Target Protein Sequence
MAEENHTMKNEFILTGFTDHPELKTLLFVVFFAIYLITVVGNISLVALIFTHRRLHTPMY IFLGNLALVDSCCACAITPKMLENFFSENKRISLYECAVQFYFLCTVETADCFLLAAMAY DRYVAICNPLQYHIMMSKKLCIQMTTGAFIAGNLHSMIHVGLVFRLVFCGSNHINHFYCD ILPLYRLSCVDPYINELVLFIFSGSVQVFTIGSVLISYLYILLTIFKMKSKEGRAKAFST CASHFLSVSLFYGSLFFMYVRPNLLEEGDKDIPAAILFTIVVPLLNPFIYSLRNREVISV LRKILMKK
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8349

KEGG: hsa:26339

STRING: 9606.ENSP00000373193

UniGene: Hs.621533

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR5K1 and what structural characteristics define it?

OR5K1 is a protein encoded by the OR5K1 gene in humans that functions as an olfactory receptor. It belongs to the largest subfamily of class A G protein-coupled receptors (GPCRs) . Like other olfactory receptors, OR5K1 shares a characteristic 7-transmembrane domain structure with many neurotransmitter and hormone receptors, which is crucial for its function in recognizing and transducing odorant signals . This receptor arises from a single coding-exon gene, and its structure includes the conserved features typical of class A GPCRs, including the disulfide bridge between C3.25 and C45.50 that helps maintain structural integrity .

How does OR5K1 transmit olfactory signals at the molecular level?

OR5K1 functions through the canonical GPCR signaling mechanism. When an appropriate odorant molecule binds to the orthosteric binding site of OR5K1, it initiates a conformational change in the receptor structure . This structural rearrangement triggers G protein-mediated signal transduction, activating downstream effectors that ultimately result in a neuronal response that contributes to smell perception . The precise activation mechanism involves the conserved GPCR activation regions, which undergo specific conformational changes to propagate the signal from the extracellular binding domain to the intracellular region where G protein coupling occurs .

What are the key challenges in studying OR5K1 structure experimentally?

Studying OR5K1 structure presents several significant challenges for researchers:

  • No experimental structures are available for olfactory receptors, including OR5K1

  • ORs share very low sequence identity with non-sensory GPCRs for which structures have been determined

  • The small size of OR modulators complicates structural studies

  • ORs are notoriously difficult to express in heterologous systems in functional form

  • The hydrophobic nature of these membrane proteins makes crystallization challenging

These limitations have necessitated computational approaches such as homology modeling and AI-based prediction methods like AlphaFold to gain structural insights into OR5K1 .

How effective are current computational approaches for modeling OR5K1?

Computational modeling has become essential for investigating OR5K1 structure due to the absence of experimental structures. Two primary approaches have been employed:

Both methods have strengths and limitations. While AlphaFold 2 can provide a good starting model, homology modeling with careful template selection and refinement, particularly of the binding site and ECL2 loop, has been necessary to develop models suitable for ligand docking studies .

What methodologies are recommended for refining OR5K1 binding site models?

For researchers seeking to develop accurate models of the OR5K1 binding site, the following methodological approach is recommended:

  • Generate initial models using either AlphaFold 2 or multi-template homology modeling with MODELLER or similar software

  • Pay special attention to refining the ECL2 loop, which has been identified as a critical region for OR modeling

  • Use induced-fit docking (IFD) simulations to sample the binding site conformational space for ensemble docking

  • Guide side chain residue sampling and model selection using available mutagenesis data

  • Validate models by their ability to discriminate between known active and inactive compounds through methods such as ROC curve analysis

This step-wise refinement process has been successfully employed to model the OR5K1 orthosteric binding site and investigate its interactions with cognate ligands .

How can researchers validate computational models of OR5K1?

Validation of OR5K1 computational models should employ multiple complementary approaches:

  • Structure-based validation: Assess model quality using standard protein structure evaluation tools that check stereochemistry, bond angles, and Ramachandran plots

  • Conservation analysis: Examine whether conserved GPCR motifs and residues are properly positioned

  • Ligand-based validation: Test the model's ability to accommodate known ligands in biologically relevant conformations

  • Mutational data correlation: Compare model predictions with experimental mutagenesis results, particularly regarding how mutations affect ligand binding or receptor function

  • Retrospective virtual screening: Evaluate the model's ability to discriminate between known active and inactive compounds using ROC curve analysis

The most stringent validation comes from the model's ability to correctly predict the effects of mutations on receptor function and to explain structure-activity relationships among cognate ligands .

What experimental approaches are recommended for identifying OR5K1 ligands?

Identifying ligands for OR5K1 requires systematic experimental approaches:

  • High-throughput screening: Test libraries of odorant compounds against cells expressing OR5K1 using calcium imaging or other functional assays

  • Structure-guided virtual screening: Use computational models to predict potential ligands, followed by experimental validation

  • Fragment-based screening: Identify molecular fragments that bind to different regions of the binding pocket and can be combined to design potent ligands

  • Competitive binding assays: Use known ligands as competitors to identify compounds that bind to the same site

The recently characterized cognate agonists for OR5K1 provide valuable starting points for these studies . When conducting these experiments, researchers should consider the following table of experimental parameters:

Screening MethodThroughputResource RequirementsFollow-up Validation
Cell-based functional assaysMediumCell lines expressing OR5K1, calcium indicatorsDose-response curves, structural analogs
Virtual screeningHighComputational resources, validated OR5K1 modelIn vitro binding/functional assays
Fragment screeningMediumNMR or SPR equipment, purified receptorFragment linking/optimization
Competitive bindingLowLabeled reference ligandBinding kinetics, thermodynamics

How do mutations in OR5K1 impact ligand binding and receptor function?

Mutations in OR5K1 can significantly alter odorant perception by affecting various aspects of receptor function:

  • Binding site alterations: Mutations in the orthosteric binding pocket can directly affect ligand recognition and binding affinity

  • Activation mechanism disruption: Changes in positions linked to the conserved GPCR activation mechanism can alter signal transduction efficiency even if binding is preserved

  • Protein stability effects: Mutations in structurally conserved regions may affect receptor folding or stability

  • Expression and trafficking: Some variants may impact receptor expression levels or proper localization to the cell membrane

The extraordinary diversity of natural variations in human olfactory receptors, including OR5K1, contributes to interindividual differences in olfactory perception . Notably, single amino acid variants in human ORs can alter the resulting phenotype by changing odorant perception .

To assess the functional impact of specific variants, researchers can use:

  • Site-directed mutagenesis followed by functional assays

  • Computational prediction tools that evaluate the severity of amino acid substitutions

  • Population frequency data to identify potentially impactful variants

What is known about natural variants of OR5K1 across human populations?

OR5K1, like other olfactory receptors, exhibits considerable genetic diversity across human populations:

  • Analysis of human genomic data reveals that OR loci harbor a considerable number of genetic variants

  • Only a small fraction (less than 5%) of OR variants have global allele frequencies above 1%, while the vast majority are low-frequency variants

  • This pattern indicates extraordinary interindividual variation in the human OR gene repertoire

  • Population-specific differences in OR5K1 variant frequencies may contribute to population-level variations in olfactory perception

Researchers studying OR5K1 should consider this genetic diversity when interpreting experimental results, particularly when making generalizations about receptor function across different human populations.

How can researchers access and analyze OR5K1 variant data?

Researchers interested in studying OR5K1 genetic variants can utilize several resources:

  • Human Olfactory Receptor Mutation Database (hORMdb): This interactive database allows selection and filtering of human OR natural variants and analysis of specific dbSNP entries, individual genes, or complete families according to topological localization, population frequencies, and substitution scores

  • gnomAD database: Contains comprehensive information on allele frequencies across seven sub-continental populations for olfactory receptor variants, including those in OR5K1

  • Analysis tools for variant impact prediction: Several computational tools are available to assess the potential functional impact of missense mutations in OR5K1 based on evolutionary conservation, structural context, and physicochemical properties of amino acid changes

When analyzing OR5K1 variants, researchers should consider:

  • Position of the variant in the receptor structure (transmembrane domains, loops, binding site)

  • Type and magnitude of amino acid change

  • Conservation of the affected residue across olfactory receptors

  • Population frequency as an indicator of potential phenotypic impact

What expression systems are most effective for producing recombinant OR5K1?

Production of functional recombinant OR5K1 presents significant challenges due to the hydrophobic nature of this membrane protein. Based on experiences with other olfactory receptors, researchers should consider:

  • Cell-free expression systems: These have been successfully used for other olfactory receptors and can produce proteins with ≥85% purity suitable for SDS-PAGE analysis

  • Specialized mammalian cell systems: HEK293 cells with specific adaptations for GPCR expression, such as inclusion of trafficking enhancers or chaperones

  • Insect cell expression: Baculovirus-infected insect cells (Sf9, Hi5) have been used successfully for other GPCRs

  • Yeast expression systems: Modified yeast strains optimized for GPCR expression

For all expression systems, optimization of constructs with appropriate purification tags, signal sequences, and potentially fusion partners (like T4 lysozyme) may be necessary to enhance expression and stability.

What analytical methods are essential for characterizing recombinant OR5K1?

Comprehensive characterization of recombinant OR5K1 should include:

  • Purity assessment: SDS-PAGE and Western blotting to confirm protein identity and purity

  • Structural integrity analysis: Circular dichroism spectroscopy to confirm proper secondary structure content expected for a 7-TM protein

  • Ligand binding assays: Direct binding measurements using labeled ligands or thermal shift assays to confirm proper folding and functionality

  • Functional assays: Reconstitution into liposomes or nanodiscs with appropriate G proteins to measure activation upon ligand binding

  • Mass spectrometry: To confirm the exact molecular weight and potential post-translational modifications

The quality control process should ensure that the recombinant OR5K1 retains the structural and functional properties of the native receptor to be useful for downstream applications.

How can structural biology techniques be applied to study OR5K1?

Despite the challenges, several advanced structural biology approaches show promise for studying OR5K1:

  • Cryo-electron microscopy (cryo-EM): This technique has revolutionized GPCR structural biology and could potentially be applied to OR5K1, especially if the receptor can be stabilized in complex with G proteins or antibody fragments

  • Solid-state NMR spectroscopy: Can provide localized structural information about specific regions of OR5K1, particularly when combined with selective isotopic labeling

  • X-ray free electron laser (XFEL) crystallography: Might overcome some limitations of traditional crystallography for membrane proteins like OR5K1

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Can provide information about conformational dynamics and ligand-induced changes in OR5K1

Each of these methods requires significant optimization of protein production, stabilization, and experimental conditions, but they represent the frontier of structural studies for challenging targets like OR5K1.

What comparative genomics approaches can enhance OR5K1 research?

Comparative genomics offers valuable insights into OR5K1 function and evolution:

  • Cross-species comparison: Analyzing OR5K1 orthologs across species can identify highly conserved residues likely critical for structure or function

  • Evolutionary analysis within the OR family: Comparing OR5K1 to other human olfactory receptors can reveal subfamily-specific features that might relate to odor specificity

  • Positive selection analysis: Identifying sites under positive selection pressure might indicate regions involved in species-specific odorant recognition

  • Correlation with olfactory phenotypes: Linking genetic variations to phenotypic differences in odorant perception across species or populations

These approaches can help prioritize residues for mutagenesis studies and provide context for interpreting experimental results with recombinant OR5K1.

How does OR5K1 research fit into the larger landscape of olfactory genomics?

OR5K1 research represents one component of the emerging "sensegenomics" field, which integrates genetic, structural, and functional data to understand sensory perception . Key considerations include:

  • The olfactory receptor gene family is the largest in the genome, with approximately 400 encoding genes in humans

  • A significant proportion of OR genes are pseudogenes, highlighting the dynamic evolutionary history of this gene family

  • Research on OR5K1 and other olfactory receptors has implications for understanding:

    • Individual variation in olfactory perception

    • Population-specific differences in odor recognition

    • The molecular basis of specific anosmias (inability to smell specific odorants)

    • The evolution of chemosensory perception

  • Integrating OR5K1 research with broader olfactory genomics requires:

    • Standardized functional characterization methods

    • Comprehensive databases of variant effects

    • Phenotype-genotype correlation studies

    • Structural information across the OR family

What are the most promising future directions for OR5K1 research?

Based on current knowledge and technological advances, promising research directions include:

  • High-resolution structural determination: As cryo-EM and other structural biology techniques advance, determining the actual structure of OR5K1 becomes increasingly feasible

  • Complete deorphanization: Identifying the full spectrum of odorants recognized by OR5K1 and characterizing their structure-activity relationships

  • In vivo functional validation: Using gene editing in model organisms to validate the role of OR5K1 in specific olfactory behaviors

  • Development of OR5K1-targeted modulators: Designing specific agonists, antagonists, or allosteric modulators as molecular probes

  • Integration with neural circuit studies: Linking OR5K1 activation to specific glomerular responses and olfactory coding in the brain

These directions will benefit from continued methodological advances in protein production, structural biology, computational modeling, and functional genomics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.