Recombinant Human Olfactory receptor 5L2 (OR5L2)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Information

Olfactory receptor 5L2 is a protein encoded by the OR5L2 gene in humans . The OR5L2 gene is part of the largest multigene family in vertebrates, with humans possessing approximately 400 olfactory receptor genes compared to 1400 in mice . OR5L2 is known by several alternative identifiers including HSHTPCRX16, HTPCRX16, and OR11-153, which are important for cross-referencing in genomic and proteomic databases .

Table 1: Key Identifiers for Human OR5L2

Identifier TypeValue
Gene SymbolOR5L2
Ensembl Transcript IDENST00000378397
Ensembl Protein IDENSP00000367650
Ensembl Gene IDENSG00000205030
Alternative NamesHSHTPCRX16, HTPCRX16, OR11-153
Pfam FamilyPF13853 (inferred from OR family)

Tissue Expression Patterns

While specific information about OR5L2's expression pattern is somewhat limited, the knowledge about its cell type or tissue distribution has a relatively high value of 0.73 on a scale from 0 to 1, suggesting significant information is available regarding its tissue expression . Knowledge about its expression in cell lines has a value of 0.68, indicating substantial research has been conducted on its expression in various cell types .

Cellular Localization

At the cellular level, OR5L2 is expected to localize to the cell membrane of olfactory sensory neurons . In vertebrates, olfactory receptors are typically located in both the cilia and synapses of the olfactory sensory neurons and in the epithelium of the human airway . This membrane localization is essential for the receptor to interact with odorant molecules in the environment and initiate signal transduction cascades.

The localization of OR5L2 specifically follows the pattern typical of olfactory receptors, which are expressed in the cell membranes of olfactory receptor neurons and are responsible for the detection of odorants which give rise to the sense of smell .

Ligand Binding Properties

Like other olfactory receptors, OR5L2 likely displays affinity for a range of odor molecules rather than binding to specific ligands exclusively . This characteristic promiscuity allows a limited number of receptors to detect a vast array of odorants. Conversely, a single odorant molecule may bind to multiple olfactory receptors with varying affinities . These binding affinities depend on physiochemical properties of molecules, such as their molecular volumes .

Table 2: General Characteristics of Olfactory Receptor-Ligand Interactions

CharacteristicDescription
Binding SpecificityBroad rather than specific; one receptor can bind multiple odorants
Binding PromiscuityOne odorant can bind multiple receptors with different affinities
Binding DeterminantsMolecular volume, functional groups, structural features
Concentration EffectsHigher concentrations increase activation probability

Although specific ligands for OR5L2 are not detailed in the available research, its function as an olfactory receptor suggests it follows similar binding patterns to other members of this receptor family. The Molecule to Olfactory Receptor database (M2OR) contains curated data on OR-molecule interactions, with information about 75,050 bioassay experiments for 51,395 distinct OR-molecule pairs, which may include data relevant to OR5L2 .

Signal Transduction Pathway

The signal transduction mechanism for OR5L2 likely follows the canonical pathway described for olfactory receptors. When an odorant binds to the receptor, it undergoes structural changes that enable it to bind and activate the olfactory-type G protein (Golf and/or Gs) on the inside of the olfactory receptor neuron . This activation initiates a signaling cascade:

  1. The activated G protein stimulates adenylate cyclase

  2. Adenylate cyclase converts ATP into cyclic AMP (cAMP)

  3. The cAMP opens cyclic nucleotide-gated ion channels

  4. These channels allow calcium and sodium ions to enter the cell

  5. The influx of ions depolarizes the olfactory receptor neuron

  6. The depolarization initiates an action potential

  7. The action potential carries the odor information to the brain

This elaborate signaling mechanism transforms the chemical recognition of odorants into electrical signals that can be processed by the olfactory bulb and higher brain centers, ultimately resulting in the perception of smell.

Expression Systems

While the search results do not provide specific information about expression systems used for the recombinant production of OR5L2, recombinant expression of GPCRs typically presents several challenges. These include proper folding, membrane insertion, and post-translational modifications that are crucial for functional activity.

Common expression systems for recombinant GPCR production include:

  • Bacterial systems (E. coli): Simple but lacking post-translational modifications

  • Yeast systems (P. pastoris, S. cerevisiae): Better for eukaryotic proteins

  • Insect cell systems (Sf9, Sf21): Good compromise between yield and proper folding

  • Mammalian cell systems (HEK293, CHO): Most physiologically relevant but lower yields

For OR5L2, an optimal expression system would need to balance protein yield with proper folding and functional activity.

Purification Methods

The purification of recombinant OR5L2 would likely involve several steps designed to isolate the functional protein while maintaining its native conformation. The hydrophobic nature of its seven transmembrane domains presents challenges for traditional purification methods.

A typical purification workflow might include:

  1. Cell lysis with detergents to solubilize membrane proteins

  2. Affinity chromatography using tags (His, FLAG, etc.) incorporated into the recombinant protein

  3. Size exclusion chromatography to separate monomeric protein from aggregates

  4. Verification of purity and activity through functional assays

The development of efficient purification protocols for OR5L2 would be crucial for structural studies and functional characterization.

Research Applications

Recombinant OR5L2 has potential applications in various research areas:

  • Structural Studies: X-ray crystallography or cryo-electron microscopy could reveal detailed structural information about ligand binding sites and conformational changes during activation.

  • Ligand Screening: High-throughput screening could identify novel agonists and antagonists for OR5L2.

  • Biosensor Development: OR5L2 could be incorporated into biosensors for specific odorant detection.

  • Drug Discovery: Understanding OR5L2's structure and function could facilitate the development of drugs targeting olfactory receptors for various medical conditions.

Physiological Functions

The primary physiological function of OR5L2 is likely the detection of odorant molecules and the initiation of signaling cascades that lead to odor perception . Knowledge about OR5L2's molecular function has a moderate value of 0.35 on a scale from 0 to 1, indicating that while some functional information is available, detailed characterization of its specific roles remains limited .

Implications in Pathological Conditions

While the search results do not provide specific information about OR5L2's involvement in pathological conditions, research has shown that olfactory receptors may play roles in various diseases, particularly cancer. Several olfactory receptors have been implicated in cancer proliferation or progression .

For example, OR51E2 and OR51E1 have been reclassified in human prostate cancer cells as prostate-specific GPCRs (PSGR and PSGR2, respectively) . OR7C1 has been identified as a novel functional marker in colorectal cancer , and OR51E1 has been implicated as a potential cancer marker in gastrointestinal neuroendocrine carcinoma .

In breast cancer specifically, transcript abundance of OR2B6 was identified in breast tumors from patients with ductal carcinoma , and both OR2B6 and OR2W3 were found to be potentially correlated with breast cancer progression . According to research on invasive breast carcinoma, OR2B6 was correlated with proliferation genes and the Luminal A subtype, while OR2W3 was correlated with invasion genes and the basal-like subtype .

Technological Advances

Future technological advances could significantly enhance our understanding of OR5L2:

  • Advanced Structural Biology Techniques: Cryo-electron microscopy and computational modeling could provide insights into OR5L2's structure and ligand binding properties.

  • Single-Cell Transcriptomics: These approaches could reveal the expression patterns of OR5L2 in specific cell types and tissues with unprecedented resolution.

  • CRISPR-Cas9 Genome Editing: This technology could be used to study the effects of OR5L2 mutations or knockouts on olfactory function and other physiological processes.

  • Artificial Intelligence: Machine learning algorithms could predict potential ligands for OR5L2 based on structural similarities to known odorants.

The development of the M2OR database, which provides curated data on OR-molecule interactions, represents an important resource for future research on olfactory receptors, including OR5L2 .

Potential Applications

Future research on OR5L2 could explore:

  • Diagnostic Applications: OR5L2 expression patterns or genetic variants could serve as biomarkers for certain diseases.

  • Therapeutic Targets: Modulating OR5L2 activity could potentially treat olfactory disorders or other conditions where this receptor plays a role.

  • Olfactory Biosensors: Recombinant OR5L2 could be incorporated into devices for environmental monitoring, food quality assessment, or medical diagnostics.

  • Personalized Medicine: Understanding individual variations in OR5L2 could help explain differences in odor perception and potentially guide personalized approaches to olfactory disorders.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary based on the purchase method and location. For specific delivery time information, please consult your local distributor.
Note: All protein shipments are made with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR5L2; Olfactory receptor 5L2; HTPCRX16; Olfactory receptor OR11-153
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR5L2
Target Protein Sequence
MGKENCTTVAEFILLGLSDVPELRVCLFLLFLLIYGVTLLANLGMTALIQVSSRLHTPVY FFLSHLSFVDFCYSSIIVPKMLANIFNKDKAISFLGCMVQFYLFCTCGVTEVFLLAVMAY DRFVAICNPLLYMVTMSQKLRVELTSCCYFCGTVCSLIHSSLALRILFYRSNVINHFFCD LPPLLSLACSDVTVNETLLFLVATLNESVTIMIILTSYLLILTTILKIHSAESRHKAFST CASHLTAITVSHGTILYIYCRPSSGNSGDVDKVATVFYTVVIPMLNPLIYSLRNKDVNKA LRKVMGSKIHS
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 8351

KEGG: hsa:26338

STRING: 9606.ENSP00000367650

UniGene: Hs.528356

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Human Olfactory Receptor 5L2 (OR5L2) and how is it classified within the olfactory receptor family?

Human Olfactory Receptor 5L2 belongs to the extensive family of olfactory receptors, which are G protein-coupled receptors expressed in olfactory sensory neurons. The human OR gene family comprises 339 intact OR genes and 297 OR pseudogenes distributed across 51 different loci on 21 human chromosomes . OR5L2, like other ORs, would be classified into a specific subfamily based on sequence relationships, with members of the same subfamily having related sequences and likely recognizing structurally related odorants .

The classification system for ORs is based on sequence similarity, with receptors sharing >60% amino acid identity typically grouped into the same subfamily. This classification has functional significance since members of the same subfamily often detect similar chemical structures, although a particular odorant type may be recognized by receptors from different subfamilies .

How does recombinant expression of OR5L2 differ from native expression, and what challenges does this present?

Recombinant expression of OR5L2, like other olfactory receptors, faces significant challenges compared to native expression. In heterologous systems, hORs are poorly expressed on the cell surface, which is critical for evaluating their response to odorants . This expression difficulty stems from several factors:

  • Poor trafficking to the plasma membrane

  • Misfolding in heterologous expression systems

  • Retention in the endoplasmic reticulum

  • Low transcription efficiency

Recent methodological advances have focused on addressing these challenges, particularly by increasing transcriptional levels. The TAR-Tat system, which employs a positive feedback mechanism to enhance transcription efficiency, has shown promise for improving both cell surface expression and functional activity of several hORs . This approach could potentially be applied to improve recombinant OR5L2 expression as well.

What types of experimental controls are essential when working with recombinant OR5L2?

When designing experiments involving recombinant OR5L2, multiple controls are necessary to ensure valid results:

Control TypePurposeImplementation Method
Negative Expression ControlVerify specificity of OR5L2 responseCells transfected with empty vector
Positive Expression ControlConfirm expression system viabilityCells expressing well-characterized OR
Vehicle ControlAccount for solvent effectsTreatment with solvent used to dissolve odorants
Non-responsive OR ControlEnsure specificity of ligand responseOR from different subfamily
Concentration Gradient ControlEstablish dose-response relationshipSerial dilutions of potential ligands

These controls help distinguish between true OR5L2 responses and artifacts of the experimental system, particularly important given the challenges in expressing functional olfactory receptors in heterologous systems .

What methodological approaches can enhance functional expression of recombinant OR5L2?

Enhancing the functional expression of recombinant OR5L2 requires addressing multiple aspects of protein expression:

Transcription Enhancement:
The TAR-Tat system represents a promising approach for increasing OR transcription efficiency. This system employs a positive feedback mechanism that has successfully improved the cell surface expression of several ORs, including OR1A1, OR6N2, and OR51M1 . For OR5L2, implementing this system would involve:

  • Construction of expression vectors containing the OR5L2 sequence downstream of the TAR element

  • Co-expression with the Tat protein to initiate the positive feedback loop

  • Optimization of the ratio between TAR-OR5L2 and Tat expression constructs

  • Verification of enhanced transcription through quantitative RT-PCR

Trafficking Enhancement:
Beyond increasing transcription, addressing trafficking issues is critical. Methodologies include:

  • Addition of trafficking enhancement sequences (e.g., rhodopsin or Lucy tags)

  • Co-expression with receptor transporting proteins (RTPs)

  • Culture at reduced temperatures (30-33°C) during expression

  • Use of chemical chaperones such as DMSO or glycerol to improve folding

Combining the TAR-Tat system with trafficking enhancement approaches may yield synergistic improvements in functional OR5L2 expression .

How can researchers determine the odorant specificity profile of OR5L2?

Determining the odorant specificity of OR5L2 requires systematic screening approaches:

High-Throughput Screening Methods:

  • Calcium imaging assays using fluorescent calcium indicators in cells expressing OR5L2

  • BRET/FRET-based assays measuring G protein coupling upon receptor activation

  • Luciferase reporter systems linked to cAMP or IP3 secondary messenger pathways

  • Automated patch-clamp recordings of OR5L2-expressing cells

Deorphanization Strategy:
When the ligands for OR5L2 are unknown, a strategic approach involves:

  • Initial screening with structurally diverse odorant panels at high concentrations

  • Follow-up with focused libraries based on preliminary hits

  • Dose-response analysis with EC50 determination for confirmed ligands

  • Structural analysis of active ligands to identify pharmacophore features

Based on patterns observed in OR subfamily functionality, if the subfamily to which OR5L2 belongs contains receptors with known ligands, these could provide starting points for deorphanization. For example, loci containing receptors for specific odor types might suggest potential ligand classes for OR5L2 .

What computational approaches can predict OR5L2 structure-function relationships?

Understanding OR5L2 structure-function relationships benefits from computational approaches:

Homology Modeling Methodology:

  • Identify appropriate GPCR templates (preferably class A GPCRs with solved structures)

  • Generate multiple alignment of OR5L2 with template sequences

  • Build homology models focusing on the ligand-binding domain

  • Refine models through energy minimization and molecular dynamics simulations

  • Validate models through Ramachandran plots and QMEAN scores

Virtual Screening Protocol:
Once a structural model is developed:

  • Prepare a library of potential ligands (based on known ligands for related ORs)

  • Perform docking simulations to identify potential binding modes

  • Score interactions based on binding energy calculations

  • Select top candidates for experimental validation

  • Iterate between computational prediction and experimental validation

The subfamily structure of the human OR family provides valuable context for these computational approaches, as ORs within the same subfamily likely recognize structurally related odorants and might share binding pocket features .

How should researchers design experiments to investigate OR5L2 response patterns to different odorants?

Designing robust experiments to investigate OR5L2 response patterns requires careful consideration of multiple variables:

Experimental Design Structure:
Implement a factorial design approach to systematically vary:

  • Odorant structure (functional groups, carbon chain length, etc.)

  • Odorant concentration (typically logarithmic dilution series)

  • Exposure time

  • Receptor expression levels

A Latin square or fractional factorial design may be appropriate for initial screening to reduce the number of experimental conditions while maintaining statistical power .

Randomization and Controls:
To ensure valid results:

  • Randomize the order of odorant presentation to minimize adaptation effects

  • Include positive and negative controls in each experimental block

  • Perform technical replicates (typically 3-4) for each condition

  • Include biological replicates with independent transfections or cell preparations

  • Implement blinding procedures for data collection and analysis when possible

Measurement Parameters:
For comprehensive characterization of OR5L2 responses:

  • Measure both response amplitude and kinetics (onset, peak time, decay)

  • Determine sensitivity (EC50 values) and efficacy (maximum response)

  • Assess potential antagonistic effects through competition assays

  • Evaluate desensitization patterns with repeated stimulations

What are the most reliable readout systems for measuring OR5L2 activation?

Several readout systems can be employed to measure OR5L2 activation, each with distinct advantages:

Readout SystemPrincipleAdvantagesLimitations
Calcium ImagingMeasures Ca²⁺ influx with fluorescent indicatorsReal-time monitoring; Single-cell resolutionPotential interference from endogenous pathways
cAMP AssaysMeasures cAMP production via luminescence/FRETHigh sensitivity; Compatible with high-throughputEnd-point measurements may miss kinetics
ElectrophysiologyDirectly measures current changesPrecise temporal resolution; Direct measurementLow throughput; Technical complexity
Internalization AssaysMeasures receptor endocytosis after activationReflects receptor biology; Compatible with fixed samplesSlow kinetics; Indirect measure of activation
Conformational BiosensorsUses FRET/BRET to detect receptor conformational changesDirect measure of receptor state; No pathway biasComplex design; May affect receptor function

The TAR-Tat system has been shown to significantly enhance the functional responses of ORs to their odorants, making these readout systems more reliable by increasing signal-to-noise ratios. This enhancement has enabled the identification of novel receptor-odorant relationships, such as identifying four hORs as n-hexanal receptors with the enhanced expression system .

How should researchers interpret contradictory results from different expression systems when studying OR5L2?

When encountering contradictory results from different expression systems in OR5L2 studies, systematic analysis is required:

Methodological Approach to Resolving Contradictions:

  • System Comparison Analysis:

    • Create a comprehensive table documenting all experimental variables across systems

    • Include cell types, expression vectors, protein tags, assay conditions, and readout methods

    • Identify systematic differences that might explain contradictory results

  • Progressive Harmonization:

    • Sequentially harmonize one variable at a time across systems

    • For example, first standardize expression vectors, then protein tags, then assay conditions

    • Determine which variable(s) are responsible for the observed differences

  • Physiological Relevance Assessment:

    • Compare results to native olfactory neurons when possible

    • Consider which system better recapitulates the natural cellular environment of OR5L2

    • Evaluate coupling efficiency to relevant G proteins in each system

  • Independent Validation:

    • Design orthogonal approaches that do not rely on the conflicting aspects

    • For instance, if functional assays conflict, validate with binding assays or structural studies

    • Consider collaborative cross-validation with laboratories using different methodologies

The challenges in heterologous expression of ORs make these contradictions common, particularly due to differences in protein processing, trafficking efficiency, and coupling to signaling pathways across expression systems .

What statistical methods are most appropriate for analyzing OR5L2 dose-response data?

Analysis of OR5L2 dose-response data requires appropriate statistical methods:

Statistical Analysis Protocol:

  • Preprocessing Steps:

    • Log-transform odorant concentrations

    • Normalize responses (typically to maximum response or positive control)

    • Identify and address outliers using robust statistical methods

  • Model Fitting:

    • Apply nonlinear regression to fit four-parameter logistic models (Hill equation):
      R=Rmin+RmaxRmin1+10(LogEC50[L])×Hill SlopeR = R_{min} + \frac{R_{max} - R_{min}}{1 + 10^{(LogEC_{50} - [L]) \times \text{Hill Slope}}}

    • Extract key parameters: EC50, Hill coefficient, Emax, baseline

    • Calculate confidence intervals for each parameter

  • Comparative Analysis:

    • For comparing responses across conditions:

      • Extra sum-of-squares F-test for nested models

      • Akaike Information Criterion (AIC) for non-nested models

    • For multiple odorant comparisons:

      • Two-way ANOVA with odorant type and concentration as factors

      • Post-hoc testing with appropriate correction for multiple comparisons

  • Visualization:

    • Generate concentration-response curves with error bars representing SEM

    • Include data points along with fitted curves

    • Use consistent scaling for comparison across multiple odorants or conditions

The proper application of these statistical methods helps distinguish between true biological differences in OR5L2 responses and experimental variability, particularly important given the challenges in achieving consistent expression levels across experiments .

How might knowledge of OR5L2 subfamily relationships guide deorphanization strategies?

Understanding OR5L2's subfamily relationships provides strategic advantages for deorphanization:

The human OR family comprises 172 subfamilies, with members of the same subfamily having related sequences (>60% sequence identity) and likely recognizing structurally related odorants . Identifying which subfamily OR5L2 belongs to could:

  • Provide candidate odorant structures for testing based on known ligands for related ORs

  • Suggest functional hypotheses based on the perceived odor qualities of those ligands

  • Guide the design of focused odorant libraries for screening

For example, if OR5L2 belongs to a subfamily containing receptors that respond to aliphatic compounds, researchers could prioritize testing homologous series of aliphatic compounds varying in carbon chain length and functional groups . Known relationships between OR subfamilies and odor perception (such as those documented in Table 4 from source ) provide valuable starting points.

What emerging technologies might overcome current limitations in OR5L2 research?

Several emerging technologies show promise for addressing current limitations in OR5L2 research:

Advanced Expression Systems:
The TAR-Tat system represents a significant advancement by increasing transcription efficiency through positive feedback mechanisms. This approach has already demonstrated success with several ORs, enhancing their functional responses . Further refinements of this system specifically optimized for OR5L2 could overcome expression limitations.

Organoid and Tissue Engineering Approaches:
Development of olfactory epithelium organoids or bioengineered tissues that better recapitulate the native environment of OR5L2 would provide more physiologically relevant experimental systems.

High-Resolution Structural Techniques:
Advances in cryo-EM technology for membrane proteins, coupled with computational approaches, might enable direct structural determination of OR5L2 in different conformational states, providing unprecedented insights into receptor-ligand interactions.

Artificial Intelligence for Ligand Prediction:
Machine learning algorithms trained on known OR-ligand pairs could predict potential OR5L2 ligands with greater accuracy, narrowing the search space for experimental validation and potentially identifying novel interactions.

The development of these technologies would address the fundamental challenges in OR research, particularly the difficulties in achieving robust functional expression that have historically limited our understanding of odorant-receptor interactions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.