Recombinant Human Olfactory receptor 5M11 (OR5M11)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression and Purification

Efforts to express OR5M11 in heterologous systems have employed advanced techniques to overcome challenges like poor cell-surface localization:

Table 1: Recombinant OR5M11 Expression Systems

Host SystemTags/Chaperones UsedPurityYieldKey Findings
HEK293S (inducible)FLAG, rho1D4, RTP1S, REEP1≥85%1.6 mg (monomer), 1.1 mg (dimer)Proper folding confirmed by circular dichroism .
HEK293T (optimized)Rho-tag, RTP1, Ric-8B, GαolfN/AN/AEnhanced surface expression via chaperones .
Commercial KitsN-terminal/C-terminal tags≥85%Lyophilized or liquidAvailable for research use (MyBioSource, Abbexa) .
  • Challenges: Native OR5M11 tends to aggregate in the endoplasmic reticulum without chaperones like RTP1S or Ric-8B .

  • Solutions: Co-expression of β2-adrenergic or M3 muscarinic receptors improves trafficking to the cell membrane .

Ligand Binding and Activation

  • Primary Ligand: Dihydrojasmone, a terpenoid odorant, binds with micromolar affinity (KdμMK_d \approx \mu M) as shown by tryptophan fluorescence assays .

  • Signal Transduction: Odorant binding activates adenylate cyclase via Gαolf, increasing intracellular cAMP levels .

Table 2: Functional Assay Parameters

Assay TypeDetection MethodDynamic RangeKey Outputs
Real-time cAMPGloSensor™ luciferase0.156–10 ng/mLDose-dependent cAMP production .
Calcium imagingGCaMP fluorescenceN/AReal-time Ca²⁺ influx linked to CNG channels .
Luciferase endpointChemiluminescenceN/AHigh-throughput screening of agonists .

Research Applications

  • Odorant Screening: OR5M11 is included in databases like M2OR, which catalogs 75,050 OR-odorant interaction experiments .

  • Biosensor Development: Integrated into cell arrays for real-time odorant response profiling (e.g., Human OR Sensor) .

  • Commercial Kits: ELISA kits (e.g., Abbexa) enable quantitative detection in biological samples .

Challenges and Future Directions

  • Low Research Coverage: OR5M11 is classified as understudied, with limited PubMed citations (score: 0.4) and no known drug associations .

  • Technical Hurdles: Low native expression levels and ligand promiscuity complicate deorphanization .

  • Emerging Tools: CRISPR-edited cell libraries and machine learning models aim to predict OR5M11 ligands and improve functional annotation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
OR5M11; Olfactory receptor 5M11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR5M11
Target Protein Sequence
MSNTNGSAITEFILLGLTDCPELQSLLFVLFLVVYLVTLLGNLGMIMLMRLDSRLHTPMY FFLTNLAFVDLCYTSNATPQMSTNIVSEKTISFAGCFTQCYIFIALLLTEFYMLAAMAYD RYVAIYDPLRYSVKTSRRVCICLATFPYVYGFSDGLFQAILTFRLTFCRSSVINHFYCAD PPLIKLSCSDTYVKEHAMFISAGFNLSSSLTIVLVSYAFILAAILRIKSAEGRHKAFSTC GSHMMAVTLFYGTLFCMYIRPPTDKTVEESKIIAVFYTFVSPVLNPLIYSLRNKDVKQAL KNVLR
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15291

KEGG: hsa:219487

STRING: 9606.ENSP00000432417

UniGene: Hs.553632

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR5M11 and what is its function in the human olfactory system?

OR5M11 (olfactory receptor family 5 subfamily M member 11) is a protein-coding gene located on chromosome 11 that encodes for olfactory receptor 5M11 . This receptor belongs to the large family of G-protein-coupled receptors (GPCRs) that function as molecular sensors for detecting odorant molecules in the nasal epithelium . When an odorant binds to OR5M11, it initiates a signaling cascade that ultimately leads to the perception of specific smells .

The functional significance of OR5M11 lies in its contribution to the discriminatory capacity of the human olfactory system. Like other olfactory receptors, OR5M11 exhibits a specific response profile to certain odorants, reflecting the combinatorial coding mechanism that enables humans to distinguish thousands of different odors with a limited number of receptors . OR5M11 is also known by the alternative name OR11-199 in some databases and literature .

What are the common expression systems for studying recombinant OR5M11?

Heterologous expression systems are essential for studying recombinant olfactory receptors, including OR5M11. The most widely used system involves human embryonic kidney (HEK293) cells, particularly stable tetracycline-inducible HEK293S cell lines that allow controlled expression of the receptor . For OR5M11 expression, researchers typically engineer the receptor with epitope tags to facilitate purification and detection, such as a C-terminal rho1D4 epitope tag and an N-terminal FLAG epitope tag .

Several factors enhance the functional expression of olfactory receptors in heterologous systems:

  • Co-expression with olfactory-specific G protein α GNAL/Gαolf, which has high affinity for ORs

  • Inclusion of Ric-8B, a chaperone of Gα protein that improves proper folding and trafficking

  • Addition of receptor transporter proteins like RTP1 or RTP2 to enhance cell surface expression

The Hana3A cell line is particularly valuable, accounting for approximately 41% of bioassay results in the literature, as it natively expresses chaperon proteins, olfactory G-protein, and accommodates rho tag systems .

What methods are used to verify the proper folding and functionality of recombinant OR5M11?

Verifying the proper folding and functionality of recombinant OR5M11 requires multiple complementary techniques:

  • Circular Dichroism (CD) Analysis: CD spectroscopy provides information about the secondary structure elements of the purified receptor, confirming that it maintains its native structural conformation after purification .

  • Functional Activity Assays: Real-time cAMP assays measure the receptor's ability to activate G-protein signaling pathways in response to odorant stimulation, confirming functional activity .

  • Surface Expression Analysis: Immunocytochemistry or flow cytometry using antibodies against the epitope tags can verify the receptor's proper localization to the cell membrane .

  • Ligand Binding Assays: Intrinsic tryptophan fluorescence assays quantify the binding affinity of the receptor to known odorant ligands, with micromolar range affinity considered typical for olfactory receptors .

  • GloSensor™ Technology: This highly sensitive luciferase-based system provides enhanced detection of cAMP generation, allowing more accurate assessment of receptor activation .

The combination of these methods provides comprehensive validation that the recombinant OR5M11 is properly folded and functionally active, which is crucial before proceeding with further structural or functional studies.

What are the optimal purification strategies for recombinant OR5M11?

Purification of recombinant OR5M11 requires careful consideration of membrane protein biochemistry to maintain structural integrity and functional activity. Based on established protocols for olfactory receptors, a multi-step purification strategy is recommended:

  • Detergent Solubilization: Initial extraction of OR5M11 from cellular membranes should employ mild detergents that preserve protein structure while efficiently solubilizing the receptor. For OR5M11, detergent screening is advised, though DDM (n-dodecyl-β-D-maltoside) and CHAPS have shown success with other olfactory receptors .

  • Affinity Chromatography: A two-step purification approach utilizing epitope tags incorporates:

    • Primary capture using anti-FLAG immunoaffinity purification to isolate tagged OR5M11 from the solubilized extract

    • Secondary purification via the C-terminal rho1D4 tag to further enhance purity

  • Size Exclusion Chromatography (SEC): Gel filtration separates monomeric and dimeric forms of the receptor while removing aggregates and contaminating proteins .

  • SEC-MALS Analysis: Size exclusion chromatography coupled with multi-angle light scattering can characterize the oligomeric state of purified OR5M11, distinguishing between monomeric and dimeric populations .

Using this approach, published work with similar olfactory receptors has achieved yields of approximately 1.6 mg for monomeric and 1.1 mg for dimeric forms from sixty T175 flasks of cultured cells . The purity and homogeneity of the receptor preparation should be verified by SDS-PAGE and Western blotting before proceeding to functional or structural studies.

How can researchers effectively measure OR5M11 response to odorants in real-time?

Real-time measurement of OR5M11 responses is critical for accurate characterization, as olfactory perception occurs rapidly and adapts within minutes. Several methodological considerations are essential for effective real-time analysis:

  • Calcium Imaging: Measuring intracellular Ca²⁺ influx in real-time provides a practical approach to monitor OR activation, as the cyclic nucleotide-activated channel (CNG) induces membrane potential changes by mobilizing Ca²⁺ ions into the cell .

  • Microarray Cell Systems: Advanced platforms utilize:

    • 0.5 mm square microwells arranged in 20×20 arrays (400 total) printed with hydrophobic ink on glass slides

    • Dispensing robots to create cell arrays with 400-500 OR-expressing cells per microwell

    • Fluorescence microscopy with video cameras for simultaneous monitoring of all wells

  • Reflux Apparatus Setup: This system enables continuous perfusion of odorant solutions while monitoring receptor responses, using:

    • Ringer's solution to dissolve odorants (simple or complex)

    • Concentration ranges of 0.01-0.1 mM for simple odorant molecules

    • Concentration ranges of 0.05-5.0 mM for complex odorant mixtures

  • Temporal Considerations: Avoid prolonged exposure of odorants to OR-expressing cells as:

    • Some odorants denature at room temperature (oxidation, hydrolysis)

    • Extended exposure may cause cytotoxicity

    • Adaptation responses that occur in natural olfaction would be missed

This integrated approach, referred to as a human olfactory receptor-expressing cell array sensor (human OR sensor), allows simultaneous and real-time measurement of OR responses to odorants, providing data that more accurately reflects the natural functioning of the olfactory system .

What are the current approaches for characterizing OR5M11-ligand interactions?

Characterizing OR5M11-ligand interactions requires multiple complementary approaches to establish binding specificity, affinity, and functional outcomes:

  • Intrinsic Tryptophan Fluorescence: This biophysical technique measures changes in the intrinsic fluorescence of tryptophan residues within the receptor upon ligand binding, enabling determination of binding affinity. For example, studies with similar olfactory receptors have shown binding affinity for cognate odorants in the micromolar range .

  • Luciferase Reporter Assays: These represent 41% of documented OR bioassay results in the literature and are particularly useful for high-throughput screening of potential ligands, utilizing cell lines such as Hana3A that express necessary chaperon proteins and G-protein components .

  • Database-Informed Approaches: The M2OR database compiles experimental data on OR-molecule interactions from 42 scientific articles, containing information on:

    • 51,395 unique OR-molecule pairs

    • 768 compounds (176 sum of isomers, 407 non-stereoisomeric molecules, 168 specific isomers)

    • Both responsive (3,100) and non-responsive (48,295) pairs

  • Comprehensive Documentation: Detailed experimental parameters should be recorded for OR5M11-ligand studies, including:

    ParameterDescription
    Molecule identifiersName, CID, CAS, InChIKey, SMILES
    Receptor informationGene name, UniProt ID, Sequence, Mutation, Species
    Response dataEC50, Efficacy, Statistical significance
    Experimental detailsCell line, Assay type, Detection method
    Concentration rangeTypically 0.01-0.1 mM (simple) or 0.05-5.0 mM (complex)
  • Structural Considerations: When evaluating ligand interactions, stereochemistry properties of molecules must be carefully curated, as OR5M11 may respond differently to specific isomers of the same compound .

This multifaceted approach provides robust characterization of OR5M11-ligand interactions, establishing both the molecular basis of binding and the functional consequences of receptor activation.

What methods are available for studying OR5M11 dimerization and protein-protein interactions?

Understanding OR5M11 dimerization and protein-protein interactions provides crucial insights into receptor function, trafficking, and signaling. Several methodological approaches can be employed:

  • Size Exclusion Chromatography-Multi-Angle Light Scattering (SEC-MALS): This technique has successfully demonstrated the presence of both monomeric and dimeric forms of olfactory receptors in purified preparations. For instance, similar studies with hOR1A1 revealed distinct monomeric and dimeric populations that could be separated and quantified .

  • Co-immunoprecipitation (Co-IP): This approach can identify direct protein-protein interactions between OR5M11 and potential binding partners by:

    • Using epitope-tagged OR5M11 (FLAG or rho1D4) for immunoprecipitation

    • Detecting co-precipitated proteins via Western blotting

    • Confirming specificity through appropriate controls

  • Yeast Two-Hybrid (Y2H) Assays: This genetic method can screen for proteins that interact with OR5M11 by:

    • Creating fusion constructs with OR5M11 and potential interacting proteins

    • Detecting interactions through reporter gene activation

    • Validating hits with secondary assays

  • Pull-Down Assays: These biochemical assays use purified, tagged OR5M11 to capture interacting proteins from cell lysates, providing a more direct measure of protein-protein interactions .

  • Bioluminescence/Fluorescence Resonance Energy Transfer (BRET/FRET): These techniques can assess protein-protein interactions in living cells by:

    • Measuring energy transfer between donor and acceptor fluorophores/luminophores

    • Providing spatial information about the proximity of interacting proteins

    • Allowing real-time monitoring of dynamic interactions

When studying OR5M11 dimerization, it is important to consider both covalent (e.g., disulfide bonds) and non-covalent interactions, as well as the potential effects of detergents and other solubilizing agents on oligomeric state. The physiological relevance of dimerization should be evaluated by correlating biochemical findings with functional outcomes in cellular assays.

How can computational methods enhance OR5M11 research and ligand discovery?

Computational approaches have become increasingly valuable for studying olfactory receptors like OR5M11, particularly given the challenges of experimental work with these membrane proteins. Several computational strategies can accelerate research and ligand discovery:

  • Homology Modeling: Despite the lack of crystal structures for most ORs, homology models based on related GPCRs can provide structural insights into OR5M11. These models can predict:

    • Three-dimensional receptor organization

    • Potential binding pockets

    • Key residues involved in ligand recognition

  • Molecular Docking: This approach can:

    • Screen virtual libraries of thousands of compounds

    • Predict binding modes and affinities

    • Prioritize compounds for experimental validation

    • Identify structural features that confer specificity

  • Machine Learning for Ligand Prediction: Using the extensive data available in databases like M2OR, which contains information on 51,395 unique OR-molecule pairs , machine learning algorithms can:

    • Identify chemical features that predict receptor activation

    • Classify compounds as likely agonists or non-binders

    • Suggest novel chemotypes for experimental testing

  • Integration with Experimental Data: The most powerful approach combines computational prediction with experimental validation:

    Computational MethodExperimental ValidationCombined Benefit
    Binding pocket predictionSite-directed mutagenesisValidation of key residues
    Virtual screeningHigh-throughput assaysEfficient discovery of new ligands
    Pharmacophore modelingStructure-activity relationshipsRational design of optimized ligands
    Molecular dynamicsLigand binding assaysUnderstanding of binding kinetics
  • Network Analysis: By analyzing the M2OR database and other resources, researchers can map the "odor space" of OR5M11 within the broader olfactory receptor network, identifying:

    • Related receptors with similar response profiles

    • Chemical scaffolds with activity across multiple receptors

    • Unique signatures that differentiate OR5M11 from other ORs

These computational approaches can significantly accelerate OR5M11 research by generating testable hypotheses, prioritizing experiments, and providing mechanistic insights that would be difficult to obtain through experimental methods alone.

What are the key challenges in OR5M11 expression and how can they be addressed?

Expressing functional OR5M11 presents several challenges common to olfactory receptors, which researchers must systematically address:

  • Poor Cell Surface Expression: Olfactory receptors often fail to traffic efficiently to the plasma membrane in heterologous systems. This can be addressed by:

    • Co-expressing accessory proteins such as receptor transporter proteins (RTPs) and receptor expression enhancing protein (REEP)

    • Using specialized cell lines like Hana3A that already express these chaperon proteins

    • Adding N-terminal signal sequences to enhance membrane targeting

    • Optimizing codon usage for the expression host

  • Structural Instability: OR5M11, like other olfactory receptors, may exhibit conformational instability. Researchers can mitigate this through:

    • Addition of stabilizing mutations identified through alanine scanning or directed evolution

    • Careful selection of detergents for solubilization and purification

    • Inclusion of ligands during purification to stabilize active conformations

    • Temperature optimization during expression and purification

  • Low Expression Yields: Obtaining sufficient quantities of purified receptor remains challenging. Strategies to improve yields include:

    • Using tetracycline-inducible expression systems for tight control of expression timing and levels

    • Scaling up culture volumes (e.g., sixty T175 flasks have yielded approximately 1.6 mg of monomeric receptor)

    • Optimizing cell density and induction conditions

    • Exploring alternative expression hosts (yeast, insect cells)

  • Verification of Functionality: Ensuring that expressed OR5M11 retains native function requires:

    • Real-time cAMP assays to confirm G-protein coupling

    • Calcium imaging to monitor response dynamics

    • Ligand binding assays using intrinsic tryptophan fluorescence

    • Comparison with native receptor responses where possible

By systematically addressing these challenges, researchers can establish robust protocols for expressing functional OR5M11, enabling detailed structural and functional studies.

How should researchers design experiments to study OR5M11 polymorphisms and their functional impacts?

Studying OR5M11 polymorphisms requires careful experimental design to establish genotype-phenotype correlations:

  • Polymorphism Identification and Selection:

    • Analyze genomic databases to identify common and rare variants in OR5M11

    • Prioritize non-synonymous SNPs that change amino acid sequence

    • Consider variants in key functional domains (ligand binding pocket, G-protein interaction sites)

    • Include diversity from different populations to capture global genetic variation

  • Functional Characterization:

    • Create a panel of OR5M11 variants using site-directed mutagenesis

    • Express each variant under identical conditions in the same cellular background

    • Ensure equivalent expression levels by quantifying surface expression

    • Perform dose-response studies with a panel of odorants to determine:

      • Changes in receptor sensitivity (EC50 values)

      • Alterations in efficacy (maximum response)

      • Shifts in ligand selectivity profiles

  • Structural Analysis:

    • Model the effects of polymorphisms on receptor structure using computational approaches

    • Correlate structural predictions with functional outcomes

    • Consider how polymorphisms might affect receptor dimerization or interactions with other proteins

  • Data Analysis Framework:

    ParameterAnalysis MethodInterpretation
    Response amplitudeNormalize to wild-typeChanges in efficacy
    EC50 valuesDose-response curvesShifts in sensitivity
    Ligand selectivityResponse to odorant panelAltered binding pocket
    Expression levelFlow cytometry/western blotTrafficking defects
    Basal activitycAMP in absence of ligandConstitutive activation
  • Physiological Relevance:

    • Correlate in vitro findings with perceptual data where available

    • Consider how polymorphisms might contribute to individual variation in odor perception

    • Develop hypotheses about evolutionary significance of common variants

This comprehensive approach enables researchers to establish how genetic variation in OR5M11 contributes to functional diversity and potentially influences individual differences in olfactory perception.

What are the best practices for data analysis and interpretation in OR5M11 research?

Robust data analysis is crucial for meaningful interpretation of OR5M11 research findings:

  • Standardized Reporting: Follow established guidelines for reporting OR-ligand interactions, including:

    • Complete dose-response curves rather than single-concentration data

    • Clear documentation of experimental conditions

    • Inclusion of appropriate positive and negative controls

    • Full disclosure of statistical methods and criteria for significance

  • Statistical Considerations:

    • Use appropriate statistical tests based on data distribution and experimental design

    • Account for multiple comparisons when screening numerous compounds

    • Consider both statistical and biological significance (effect size)

    • Implement robust methods to identify and handle outliers

  • Data Integration Strategies:

    • Cross-reference findings with databases like M2OR that contain information on 51,395 unique OR-molecule pairs

    • Compare results across different assay formats (cAMP, calcium, binding)

    • Reconcile discrepancies between functional and binding data

    • Place findings in context of the broader olfactory receptor family

  • Addressing Contradictory Results:

    • When different studies report conflicting findings for OR5M11, consider:

      • Methodological differences in receptor expression systems

      • Variations in assay sensitivity and detection methods

      • Potential effects of receptor tagging and modifications

      • Differences in data analysis and normalization procedures

  • Validation Framework:

    Data TypeValidation ApproachQuality Control
    Binding dataReplicate with different methodsScatchard analysis for binding sites
    Functional responsesTest in multiple cell backgroundsDose-response relationships
    Structure predictionsExperimental testing of key residuesConservation analysis
    Ligand predictionsBlind testing of novel compoundsComparison to known ligands

By implementing these best practices, researchers can ensure that data from OR5M11 studies is reliable, comparable across laboratories, and contributes meaningfully to our understanding of olfactory receptor function.

What emerging technologies hold promise for advancing OR5M11 research?

Several cutting-edge technologies are poised to transform OR5M11 research and overcome long-standing challenges in the field:

  • Cryo-Electron Microscopy (Cryo-EM): As this technique continues to advance, it offers the potential to determine the structure of OR5M11 at near-atomic resolution without the need for crystallization. Previous work with other olfactory receptors has shown that purified receptor preparations can be suitable for structural studies .

  • Single-Cell Technologies: These approaches enable:

    • Analysis of OR5M11 expression in individual olfactory sensory neurons

    • Correlation of receptor expression with functional properties

    • Investigation of cell-to-cell variability in receptor trafficking and signaling

  • Microfluidic Cell Arrays: Advanced platforms for real-time monitoring of OR responses can be further developed to:

    • Enable higher throughput screening of potential ligands

    • Provide more physiologically relevant conditions

    • Allow simultaneous comparison of multiple OR variants

  • CRISPR-Based Approaches: Gene editing technologies facilitate:

    • Creation of isogenic cell lines expressing OR5M11 variants

    • Development of animal models with humanized OR5M11

    • Systematic dissection of signaling pathways through targeted modifications

  • Human Olfactory DX Technology: This emerging concept aims to recreate human olfactory discrimination capabilities in vitro by:

    • Measuring real-time responses of all human ORs to odorants

    • Creating comprehensive odor response profiles

    • Developing predictive models of olfactory perception

These technologies, particularly when used in combination, promise to overcome current limitations in OR5M11 research and provide unprecedented insights into receptor structure, function, and physiological significance.

How can OR5M11 research contribute to broader understanding of human olfaction?

Research on OR5M11 has implications that extend beyond this specific receptor to enhance our broader understanding of human olfaction:

  • Combinatorial Coding of Odors: By determining the specific response profile of OR5M11 and integrating this with data from other receptors, researchers can better understand how the combinatorial activation of multiple receptors encodes complex odors.

  • Structure-Function Relationships: Detailed characterization of OR5M11-ligand interactions contributes to deciphering the molecular basis of odorant recognition across the receptor family, potentially revealing common principles and unique features.

  • Evolutionary Insights: Comparative studies of OR5M11 across species can illuminate:

    • How receptor function has evolved in response to environmental pressures

    • The relationship between genetic variation and functional diversity

    • The basis for species-specific olfactory capabilities

  • Translational Applications: Fundamental OR5M11 research has potential applications in:

    • Development of olfactory-based diagnostic tools

    • Creation of improved artificial sensing technologies

    • Better understanding of olfactory disorders

  • Integration with Systems Neuroscience: Connecting molecular mechanisms of OR5M11 activation with higher-level olfactory processing can bridge the gap between receptor biology and perception, contributing to a comprehensive model of olfactory system function.

By placing OR5M11 research within this broader context, investigators can ensure that their findings contribute meaningfully to the field of olfactory research while addressing fundamental questions about sensory perception.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.