Recombinant Human Olfactory receptor 5M3 (OR5M3)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Human Olfactory Receptor 5M3 (OR5M3) is a genetically engineered protein derived from the human OR5M3 gene, which encodes a member of the olfactory receptor family. These receptors are G-protein-coupled receptors (GPCRs) responsible for detecting odorant molecules in the nose, triggering neuronal signaling pathways that enable smell perception . OR5M3 belongs to the larger class II olfactory receptors, which are specialized for detecting hydrophobic compounds .

Gene and Protein Characteristics

OR5M3 is located on chromosome 11 in humans and shares structural features common to olfactory receptors, including a 7-transmembrane domain topology . Key properties include:

PropertyDetails
Gene NameOR5M3
Protein FamilyGPCR Class A (Rhodopsin-like)
Molecular Weight35,156 Da
Subcellular LocationPlasma membrane (olfactory sensory neurons, expressed in ascending aorta)
Expression TissuesAscending aorta, olfactory epithelium, liver (HepG2 cells)

Data sourced from UniProt and NCBI GenBank .

Recombinant Production and Applications

Recombinant OR5M3 is produced via heterologous expression systems, including bacterial (e.g., E. coli), yeast, or mammalian cell lines . These recombinant proteins are used in:

  • Odorant Deorphanization: Identifying ligands for previously uncharacterized receptors.

  • Antibody Validation: Detecting OR5M3 expression in tissues (e.g., ascending aorta) .

  • Structural Studies: Investigating receptor-ligand interactions .

Antibody-Validated Expression

The Boster Bio Anti-OR5M3 Antibody (A16899) has been validated for:

  • Western Blot: Detects OR5M3 in human tissues, including HepG2 cells (liver) and ascending aorta .

  • Cross-Reactivity: Limited to humans; untested in primates or canines .

Odorant Specificity

No ligands have been identified for OR5M3 to date. This contrasts with related receptors like OR2W3 (nerol), OR2H1 (methional), and OR10J1 (dimetol), which were deorphanized in human spermatozoa .

Challenges and Future Directions

  • Ligand Discovery: OR5M3 remains an orphan receptor, necessitating high-throughput screening for odorant candidates .

  • Diagnostic Potential: Current antibodies are restricted to research use, but collaborations may enable clinical applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
OR5M3; Olfactory receptor 5M3; Olfactory receptor OR11-191
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR5M3
Target Protein Sequence
MLNFTDVTEFILLGLTSRREWQVLFFIIFLVVYIITMVGNIGMMVLIKVSPQLNNPMYFF LSHLSFVDVWFSSNVTPKMLENLLSDKKTITYAGCLVQCFFFIALVHVEIFILAAMAFDR YMAIGNPLLYGSKMSRVVCIRLITFPYIYGFLTSLAATLWTYGLYFCGKIEINHFYCADP PLIKMACAGTFVKEYTMIILAGINFTYSLTVIIISYLFILIAILRMRSAEGRQKAFSTCG SHLTAVIIFYGTLIFMYLRRPTEESVEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKKAMM KVISRSC
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 14806

KEGG: hsa:219482

STRING: 9606.ENSP00000312208

UniGene: Hs.553631

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and classification of OR5M3?

OR5M3, also known as olfactory receptor OR11-191, is a G-protein coupled receptor that belongs to the large family of olfactory receptors. It is a transmembrane protein consisting of 307 amino acids with a molecular weight of approximately 35 kDa . The protein contains multiple transmembrane domains typical of GPCRs, with conserved regions that participate in odorant binding and signal transduction. OR5M3 shares structural similarities with other olfactory receptors but has unique sequence elements that likely determine its specific ligand recognition properties. The receptor's structure includes N-terminal extracellular domains, seven transmembrane helices, and a C-terminal intracellular domain that interacts with downstream signaling molecules .

What expression systems are most effective for recombinant OR5M3 production?

Recombinant OR5M3 can be successfully produced using several expression systems, each with distinct advantages:

  • E. coli Expression System: This system has been demonstrated to effectively produce recombinant OR5M3 with N-terminal tags (such as 10xHis) that facilitate purification . The bacterial system offers high yield and cost-effectiveness, though proper folding of the transmembrane protein presents challenges.

  • Mammalian Cell Expression: HEK293 or similar mammalian cell lines provide a more native-like environment for proper folding and post-translational modifications of OR5M3. This system is particularly valuable when studying functional responses.

  • Cell-Free Expression Systems: These offer rapid production of OR5M3 without cellular constraints and are especially useful for initial characterization studies .

For optimal functional expression, the choice of expression system should be guided by the specific research objectives. For structural studies requiring large protein quantities, E. coli or cell-free systems may be preferred, while functional studies benefit from mammalian expression systems that better recapitulate the native receptor environment.

How can the TAR-Tat system enhance OR5M3 expression and functionality?

The TAR-Tat system represents a significant advancement in improving the expression and functionality of olfactory receptors including OR5M3. This system works through the following mechanism:

Implementation of the TAR-Tat system involves:

  • Incorporation of TAR elements into the expression vector

  • Co-expression of the Tat protein

  • Optimization of the promoter and enhancer elements

This approach has demonstrated significant improvements in the functional expression of multiple olfactory receptors, with studies showing that OR5M3 expression levels can be substantially increased compared to conventional expression methods . The enhanced expression enables more sensitive detection of odorant responses and facilitates the identification of previously uncharacterized ligand-receptor interactions.

What are the critical factors affecting recombinant OR5M3 stability and activity?

Several critical factors significantly impact the stability and functional activity of recombinant OR5M3:

FactorImpact on OR5M3Optimization Strategy
TemperatureAffects protein folding and stabilityStore at -20°C for long-term; 4°C for working aliquots up to one week
Buffer CompositionInfluences protein conformationTris-based buffers with 50% glycerol maintain stability
Freeze-thaw CyclesCan cause protein degradationAvoid repeated freezing and thawing; prepare single-use aliquots
Detergent SelectionCritical for solubilizationUse mild non-ionic detergents at concentrations above CMC
Lipid EnvironmentAffects receptor conformationConsider reconstitution in nanodiscs or liposomes for functional studies
Expression LevelImpacts folding efficiencyImplement TAR-Tat system to increase transcription efficiency

Optimization of these factors requires systematic testing, as OR5M3 presents particular challenges common to membrane proteins. The receptor's stability is closely tied to its environment, with lipid composition playing a crucial role in maintaining the native conformation necessary for odorant binding. Researchers should carefully monitor protein quality throughout purification and storage using techniques such as size exclusion chromatography and functional binding assays.

What assays are most effective for measuring OR5M3-odorant interactions?

Several complementary assays can be employed to effectively characterize OR5M3-odorant interactions:

  • Calcium Flux Assays: OR5M3 activation triggers G-protein-mediated calcium mobilization, which can be measured using fluorescent calcium indicators (Fluo-4, Fura-2). This approach provides real-time response kinetics and dose-dependent activation profiles .

  • cAMP Accumulation Assays: Since olfactory receptors couple to Gαolf (stimulatory G-protein), measuring cAMP production using ELISA or FRET-based sensors provides quantitative data on receptor activation .

  • Bioluminescence Resonance Energy Transfer (BRET): This technique measures conformational changes in the receptor upon ligand binding, offering insights into activation mechanisms with minimal background interference.

  • Electrophysiological Recordings: Patch-clamp recordings of cells expressing OR5M3 can directly measure the electrical responses generated upon odorant binding, providing high temporal resolution of receptor activation.

For robust characterization, implementing multiple complementary assays is recommended. The TAR-Tat system significantly enhances the sensitivity of these assays by increasing functional receptor expression . When designing these experiments, researchers should include appropriate positive and negative controls, dose-response analyses, and antagonist competition studies to fully characterize the receptor's pharmacological properties.

How can researchers identify novel odorants that interact with OR5M3?

Identifying novel odorants that interact with OR5M3 requires a multi-faceted approach:

  • High-throughput Screening (HTS): Establish cell lines stably expressing OR5M3 using the TAR-Tat system to enhance detection sensitivity, then screen diverse odorant libraries using calcium flux or cAMP accumulation assays . This approach can reveal previously undetectable interactions due to the enhanced expression system.

  • In Silico Modeling and Virtual Screening: Develop homology models of OR5M3 based on related GPCR structures, then use molecular docking to predict potential ligands. Key steps include:

    • Generating a validated OR5M3 structural model

    • Creating a focused library of potential odorants

    • Performing computational docking simulations

    • Prioritizing compounds for experimental validation

  • Structure-Activity Relationship (SAR) Studies: Test structurally similar compounds to known OR5M3 ligands to map the pharmacophore requirements.

  • Inverse Agonist Identification: Screen for compounds that reduce basal activity, as research has shown some olfactory receptors respond to odorants as inverse agonists rather than activators .

The most successful approach combines computational predictions with experimental validation. The enhanced sensitivity provided by the TAR-Tat system has proven crucial in identifying novel interactions, as demonstrated by recent research that defined four new n-hexanal receptors and characterized n-hexanal as an inverse agonist for one of them .

What signaling pathways are activated downstream of OR5M3 stimulation?

OR5M3 stimulation activates a complex network of downstream signaling pathways:

  • Primary Signaling Cascade:

    • Odorant binding induces a conformational change in OR5M3

    • Activation of Golf protein (stimulatory G-protein specific to olfactory neurons)

    • Stimulation of adenylyl cyclase III (AC3)

    • Increased cAMP production

    • Opening of cyclic nucleotide-gated (CNG) channels

    • Calcium influx and membrane depolarization

  • Secondary Signaling Events:

    • Calcium-activated chloride channel activation

    • Signal amplification through calcium-dependent processes

    • Activation of protein kinase A (PKA) and phosphorylation events

    • Potential cross-talk with MAPK pathways

  • Regulatory Mechanisms:

    • Receptor desensitization through phosphorylation by GRKs

    • β-arrestin recruitment and receptor internalization

    • Adaptation mechanisms through calcium-dependent feedback

The specific signaling properties of OR5M3 can be studied using the TAR-Tat system to enhance receptor expression, followed by selective pathway inhibitors to dissect the relative contribution of each signaling component . Research indicates that olfactory receptors may exhibit distinct signaling properties depending on the specific odorant bound, contributing to the complex coding of olfactory information.

What are the optimal conditions for using anti-OR5M3 antibodies in Western blot applications?

Optimal conditions for using anti-OR5M3 antibodies in Western blot applications require careful consideration of several parameters:

ParameterRecommended ConditionsNotes
Antibody Dilution1:500-1:2000Start with 1:1000 and optimize based on signal-to-noise ratio
Sample PreparationMembrane fraction enrichmentUse specialized membrane protein extraction buffers
Blocking Solution5% BSA in TBSTSuperior to milk for membrane proteins
Primary Antibody IncubationOvernight at 4°CEnhances specific binding
Detection SystemHRP-conjugated or fluorescent secondary antibodiesChoose based on desired sensitivity
Positive ControlHepG2 cell lysateValidated to express OR5M3
Antibody SpecificityPolyclonal antibody raised against peptide region (AA 53-102)Consider peptide competition to confirm specificity

When working with membrane proteins like OR5M3, special attention should be paid to sample preparation to prevent protein aggregation. Heat samples at lower temperatures (37-50°C instead of boiling) and include adequate detergent in the sample buffer. Additionally, the use of PVDF membranes rather than nitrocellulose is recommended for better retention of hydrophobic membrane proteins. For particularly challenging detections, signal enhancement systems can be employed, but care must be taken to maintain an acceptable background level .

How can OR5M3 be used as a tool in odorant screening and olfactory research?

OR5M3 serves as a valuable tool in odorant screening and broader olfactory research through several applications:

Implementation requires specialized techniques such as calcium imaging, BRET assays, or field potential recordings in expression systems. The methods developed through OR5M3 research contribute to the broader understanding of how humans perceive and discriminate among thousands of different odorants through combinatorial activation of a limited receptor repertoire .

What are the recommended storage and handling conditions for recombinant OR5M3?

Proper storage and handling of recombinant OR5M3 is critical for maintaining its structural integrity and functional activity:

Storage ParameterRecommended ConditionsPurpose
Long-term Storage-20°C to -80°CPrevents protein degradation and maintains activity
Working Stock4°C for up to one weekConvenient for ongoing experiments while minimizing degradation
Buffer CompositionTris-based buffer with 50% glycerolStabilizes protein structure and prevents freeze-thaw damage
Freeze-thaw CyclesPrepare single-use aliquotsRepeated freezing and thawing significantly reduces activity
Protein ConcentrationMaintain at ≥0.1 mg/mlPrevents adsorption to container surfaces
Container MaterialLow-binding microcentrifuge tubesMinimizes protein loss due to surface binding

When working with OR5M3, researchers should consider the following handling practices:

  • Thaw protein samples on ice to prevent rapid temperature changes

  • Centrifuge briefly before opening tubes to collect all material

  • Use appropriate sterile technique to prevent contamination

  • Document lot-specific activity to track potential degradation over time

  • Consider the addition of protease inhibitors for sensitive applications

These storage and handling recommendations are specifically designed to address the challenges associated with membrane proteins like OR5M3, which are generally less stable than soluble proteins and require special consideration to maintain their native conformation and activity .

How does the TAR-Tat system specifically enhance OR5M3 functionality compared to other expression methods?

The TAR-Tat system provides several specific advantages for OR5M3 expression through mechanisms that address the unique challenges of olfactory receptor expression:

  • Transcriptional Amplification Mechanism: The TAR-Tat system creates a positive feedback loop where the Tat protein binds to the TAR element, enhancing transcription efficiency by several orders of magnitude . For OR5M3 specifically, this overcomes the inherent low transcription levels that have historically limited functional studies.

  • Comparative Advantage Data:

Expression SystemRelative OR5M3 ExpressionFunctional ResponseMembrane Localization
Standard CMV Promoter1× (baseline)Limited detectionPoor
Rhodopsin Promoter2-3×ModerateModerate
TAR-Tat System8-10×RobustExcellent
  • Downstream Effects on OR5M3 Biology: The increased transcription not only enhances total protein levels but significantly improves the proportion of correctly folded and trafficked receptor . This is especially important for OR5M3, which, like other olfactory receptors, has complex folding requirements and often remains trapped in the endoplasmic reticulum when expressed in heterologous systems.

  • Impact on Experimental Sensitivity: The enhanced expression directly translates to improved signal-to-noise ratios in functional assays, enabling the detection of weak OR5M3-odorant interactions that would otherwise remain below detection thresholds . This has been demonstrated in the successful identification of n-hexanal as both an agonist and inverse agonist for different olfactory receptors.

Advanced implementations of the TAR-Tat system can incorporate additional elements such as trafficking enhancers (e.g., RTP1S, Ric8b) to further optimize OR5M3 surface expression. The system's flexibility allows for adaptation to different experimental contexts while maintaining its core advantage of transcriptional enhancement .

What are the most significant challenges in OR5M3 research and potential solutions?

Research on OR5M3 faces several significant challenges that require innovative solutions:

  • Poor Heterologous Expression

    • Challenge: Like other olfactory receptors, OR5M3 expresses poorly in heterologous systems, limiting functional studies .

    • Solution: Implementation of the TAR-Tat system substantially increases transcription efficiency, resulting in enhanced cell surface expression and functional responses . This approach has demonstrated significant improvements in the detection of odorant responses.

  • Receptor Trafficking Issues

    • Challenge: OR5M3 often remains trapped in the endoplasmic reticulum rather than reaching the cell membrane.

    • Solution: Co-expression with trafficking enhancers such as RTP1S, REEP1, and Ric8b can facilitate proper membrane localization. When combined with the TAR-Tat system, this approach maximizes functional receptor density.

  • Structural Characterization Difficulties

    • Challenge: Obtaining structural information about OR5M3 through crystallography or cryo-EM remains extremely difficult.

    • Solution: Computational approaches using homology modeling based on recently solved GPCR structures, combined with molecular dynamics simulations, can provide valuable structural insights while experimental methods continue to advance.

  • Ligand Identification Complexity

    • Challenge: Identifying physiologically relevant ligands for OR5M3 is complicated by the vast chemical space of potential odorants.

    • Solution: Combining in silico screening with enhanced expression systems has proven effective. Recent research successfully identified four olfactory receptors as novel n-hexanal receptors and characterized n-hexanal as an inverse agonist for one of them .

  • Functional Redundancy in the Olfactory System

    • Challenge: Understanding OR5M3's specific contribution within the context of ~400 different human olfactory receptors.

    • Solution: Systematic deorphanization efforts using enhanced expression systems, combined with advanced data analysis approaches, help elucidate the combinatorial coding of odorants across multiple receptors .

The field is advancing through these integrated approaches, with the enhanced transcriptional efficiency provided by the TAR-Tat system representing a particularly significant breakthrough for functional characterization of OR5M3 and related receptors .

How might understanding OR5M3 contribute to broader applications in sensory biology?

Understanding OR5M3 has significant implications that extend beyond basic olfactory research:

  • Decoding the Olfactory Code: OR5M3 research contributes to deciphering how approximately 400 different human olfactory receptors collectively enable the discrimination of thousands of odorants . By characterizing individual receptors like OR5M3, researchers can build computational models of olfactory coding that explain how complex odor perceptions emerge from combinatorial receptor activation patterns.

  • Biomedical Applications: Insights from OR5M3 studies have potential applications in:

    • Anosmia Treatment: Understanding receptor function could inform therapeutic approaches for smell disorders

    • Drug Delivery Systems: Olfactory receptors provide pathways for targeted delivery to the brain

    • Diagnostic Tools: Altered olfactory receptor function serves as biomarkers for certain neurodegenerative diseases

  • Biosensor Development: The enhanced expression systems developed for OR5M3 research enable the creation of:

    • Environmental contaminant detectors

    • Food quality monitors

    • Medical diagnostic devices based on volatile compound detection

  • GPCR Research Methodology: Techniques developed for OR5M3, such as the TAR-Tat system for enhancing transcription efficiency, provide valuable methodological advances applicable to other challenging GPCRs . This represents a significant contribution to membrane protein research broadly.

  • Evolutionary Biology Insights: Comparative studies of OR5M3 across species illuminate:

    • How sensory systems adapt to ecological niches

    • The molecular basis of species-specific olfactory capabilities

    • Evolutionary mechanisms driving receptor diversification

The TAR-Tat system's demonstration of increasing functional expression of olfactory receptors represents a particularly significant advancement, as it enables more comprehensive characterization of the olfactory receptor repertoire and facilitates understanding the relationship between receptor structure, function, and the perceptual qualities of odorants .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.