Recombinant Human Olfactory receptor 5M9 (OR5M9)

Shipped with Ice Packs
In Stock

Description

Functional Insights

While direct ligand data for OR5M9 remains limited, studies on homologous olfactory receptors reveal:

  • Activation Mechanism: Odorant binding triggers G-protein (G<sub>olf</sub>/G<sub>s</sub>) signaling, increasing cAMP and depolarizing neurons .

  • Ligand Specificity: Olfactory receptors typically recognize multiple odorants with micromolar affinity ranges . For example, the related hOR1A1 binds dihydrojasmone with K<sub>d</sub> ≈ µM .

  • Dimerization Potential: Size exclusion chromatography shows monomeric and dimeric forms in purified preparations .

Research Applications

Recombinant OR5M9 is utilized in:

  • Structural Studies: Purification protocols involving anti-FLAG affinity chromatography and gel filtration enable crystallographic/NMR investigations .

  • Assay Development: Used in ELISA, Western blot (WB), and immunofluorescence (IF) for receptor localization studies .

  • Ligand Screening: Intrinsic tryptophan fluorescence assays quantify odorant binding .

Challenges and Future Directions

  • Low Yield: Purification yields remain modest (~1.6 mg monomer from 60 T175 flasks) .

  • Ligand Identification: OR5M9’s specific odorants are uncharacterized, necessitating high-throughput screening via databases like M2OR .

  • Structural Resolution: No solved 3D structure exists, though AlphaFold predictions are available .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them in your order remarks and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR5M9; Olfactory receptor 5M9; Olfactory receptor OR11-190
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR5M9
Target Protein Sequence
MPNFTDVTEFTLLGLTCRQELQVLFFVVFLAVYMITLLGNIGMIILISISPQLQSPMYFF LSHLSFADVCFSSNVTPKMLENLLSETKTISYVGCLVQCYFFIAVVHVEVYILAVMAFDR YMAGCNPLLYGSKMSRTVCVRLISVPYVYGFSVSLICTLWTYGLYFCGNFEINHFYCADP PLIQIACGRVHIKEITMIVIAGINFTYSLSVVLISYTLIVVAVLRMRSADGRRKAFSTCG SHLTAVSMFYGTPIFMYLRRPTEESVEQGKMVAVFYTTVIPMLNPMIYSLRNKDVKEAVN KAITKTYVRQ
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15294

KEGG: hsa:390162

STRING: 9606.ENSP00000279791

UniGene: Hs.553749

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR5M9 and what is its fundamental role in the olfactory system?

OR5M9 (Olfactory Receptor 5M9, also known as Olfactory Receptor OR11-190) is a member of the olfactory receptor family involved in odorant detection and discrimination. Like other olfactory receptors, OR5M9 belongs to the G protein-coupled receptor (GPCR) superfamily characterized by a seven α-helices transmembrane structure. The receptor plays a key role in the olfactory system, where it contributes to the detection and discrimination of specific odorants . Olfactory receptors generally function by binding to specific odorant molecules, which triggers a signaling cascade that ultimately results in the perception of smell.

What are the structural characteristics and domains of OR5M9?

OR5M9, as a member of the olfactory receptor family and GPCR superfamily, possesses the characteristic structural features of seven transmembrane α-helices connected by three extracellular loops (ECLs) and three intracellular loops (ICLs) . The transmembrane domains form a central binding pocket where odorant molecules interact with the receptor. The structure can be divided into several key domains:

  • Transmembrane domains (TM1-TM7): Form the core structure of the receptor

  • Extracellular loops (ECL1-3): Play crucial roles in odorant recognition and binding

  • Intracellular loops (ICL1-3): Involved in G protein coupling and downstream signaling

  • N-terminal domain: Located extracellularly

  • C-terminal domain: Located intracellularly

Based on studies of similar olfactory receptors, ECL2 likely plays a pivotal role in shaping and regulating the volume of the OR5M9 odorant-binding pocket, maintaining its hydrophobic properties, and serving as a gatekeeper for odorant binding . Similarly, ECL3 may be involved in stabilizing odorants, facilitating receptor activation. The transmembrane regions TM-3, TM-5, and TM-6 are potential hotspots for odorant binding, as observed in other olfactory receptors .

How can researchers detect and quantify OR5M9 expression in various tissues?

The detection and quantification of OR5M9 expression in various tissues require specific methodologies due to the typically low expression levels of olfactory receptors. Several validated approaches include:

Antibody-based detection methods:
The OR5M9 Antibody (e.g., PACO04196) is a highly specific and sensitive tool validated for multiple applications :

ApplicationRecommended DilutionNotes
Western Blotting (WB)1:500-1:2000Detects denatured protein
Immunofluorescence (IF)1:200-1:1000Visualizes cellular localization
ELISAPer manufacturer protocolQuantitative detection

This polyclonal antibody, generated in rabbits, targets a synthesized peptide derived from the internal region of human OR5M9, enabling researchers to investigate the expression and localization of OR5M9 in different tissues and cell types .

RNA-based detection methods:

  • RT-PCR: Primers specific to OR5M9 can be designed to amplify its mRNA

  • RNA-Seq: For transcriptome-wide analysis of OR5M9 expression across tissues

  • In situ hybridization: To visualize OR5M9 mRNA in tissue sections

These methodologies allow researchers to comprehensively assess the expression patterns of OR5M9 across different tissues, providing insights into potential non-olfactory functions of this receptor.

How do the binding mechanisms between OR5M9 and odorant molecules function?

While specific binding mechanisms for OR5M9 have not been fully characterized, insights can be gained from studies of other olfactory receptors. Based on research with similar receptors, OR5M9 likely interacts with odorants through a combination of:

  • Polar interactions: Including hydrogen bonds and ionic interactions

  • Non-specific hydrophobic interactions: Contributing to binding stability

  • π-π stacking: Particularly important for aromatic odorants

Studies on other olfactory receptors have revealed that transmembrane regions TM-3, TM-5, and TM-6 often serve as preferred binding sites for odor molecules . The binding pocket is typically compact and enclosed, effectively entrapping the odorant molecule as demonstrated in the OR51E2 receptor's interaction with propionic acid .

For researchers investigating OR5M9 binding mechanisms, a combination of experimental and computational approaches is recommended:

ApproachApplicationAdvantages
Cryo-EMStructural determinationHigh-resolution structural data
AlphaFold2Structure predictionComputational efficiency when experimental structures unavailable
Molecular dockingPredict binding posesEfficient screening of potential ligands
Molecular dynamicsSimulate binding dynamicsAccounts for protein flexibility and solvation effects
Mutagenesis studiesIdentify key residuesExperimental validation of binding models

These approaches can help identify the specific amino acid residues in OR5M9 that interact with odorants, as well as the nature of these interactions.

What role do extracellular loops play in OR5M9 function and ligand specificity?

Extracellular loops (ECLs) in olfactory receptors, including OR5M9, play critical roles in ligand recognition, binding, and receptor activation. Based on studies of related olfactory receptors, the functions of ECLs in OR5M9 likely include:

ECL2 functions:
ECL2 has been shown to play a pivotal role in shaping and regulating the volume of the odorant-binding pocket in olfactory receptors . It maintains the hydrophobic properties of the pocket and serves as a gatekeeper for odorant binding . For OR5M9, ECL2 likely influences both the diversity and specificity of responses to different odorants.

ECL3 functions:
Studies on OR51E2 have demonstrated that conformational alterations within ECL3 play a crucial role in receptor activation . ECL3 is hypothesized to stabilize odorants, facilitating further activation of the receptor. This stabilization is essential for the diverse activation patterns necessary for odor recognition .

Researchers studying the role of ECLs in OR5M9 function should consider the following methodological approaches:

  • Targeted mutagenesis: Modifying specific amino acid residues within ECL2 and ECL3 to assess their impact on ligand binding and receptor activation

  • Chimeric receptors: Creating chimeras between OR5M9 and other receptors by swapping ECL regions to determine their contribution to ligand specificity

  • Molecular dynamics simulations: Analyzing the conformational changes in ECLs during odorant binding and receptor activation

  • Structural modeling: Predicting ECL conformations using computational tools like AlphaFold2

These approaches can provide valuable insights into how ECLs contribute to OR5M9's selectivity for specific odorants.

How can computational models predict OR5M9's response to novel odorants?

Computational modeling approaches have become increasingly powerful for predicting olfactory receptor responses to novel odorants. For OR5M9, several computational strategies can be employed:

Protein Chemistry Metric (PCM) models:
Similar to the model developed by Jérôme Golebiowski's team, PCM models can predict OR5M9 responses based on receptor sequence similarity and the physicochemical characteristics of ligands . Using supervised machine learning, these models can forecast OR5M9's responses to novel odorants, potentially achieving hit rates of around 58% as demonstrated with other olfactory receptors .

Molecular docking and virtual screening:
This approach can identify potential novel antagonists or agonists for OR5M9 with success rates potentially reaching 70%, as demonstrated with the mOR256-3 receptor . The process involves:

  • Preparing a library of candidate odorant molecules

  • Generating an OR5M9 structural model (using AlphaFold2 or homology modeling)

  • Conducting virtual screening through molecular docking

  • Selecting top candidates based on binding energy and interaction patterns

  • Validating predictions through cell-based assays

Molecular field-based similarity analysis:
This technique can identify ligands with similar binding properties to known OR5M9 agonists by analyzing their molecular fields . The approach has successfully identified ligands for other olfactory receptors such as OR1G1 and OR52H1 .

Computational MethodData RequirementsPrediction CapabilityValidation Method
PCM ModelsOR sequence, known ligand-OR pairsOdorant response predictionCell-based assays
Molecular DockingOR structure, ligand structuresBinding affinity, interaction patternsBinding assays, mutagenesis
Molecular Field AnalysisKnown ligand structuresSimilar ligands identificationFunctional assays
MD SimulationsOR structure, ligand structureBinding dynamics, conformational changesExperimental structure data

Researchers should validate computational predictions through experimental methods, including calcium imaging, luciferase reporter assays, or electrophysiology.

What are the best techniques for expressing and purifying recombinant OR5M9?

Expression systems for recombinant OR5M9:

Expression SystemAdvantagesConsiderations
HEK293 cellsMammalian glycosylation, traffickingModerate yield, familiar to many labs
SF9 insect cellsHigher protein yield, eukaryotic processingMore complex media requirements
E. coli (with fusion partners)High yield, economicalLacks post-translational modifications
Cell-free systemsAvoids toxicity issues, rapidLower yields, higher cost

Strategies to enhance expression:

  • Fusion partners: Adding tags such as maltose-binding protein (MBP), thioredoxin, or SUMO can improve folding and stability

  • Codon optimization: Adapting the OR5M9 sequence to the expression host's codon preference

  • Inducible promoters: Controlling expression timing to minimize toxicity

  • Culture conditions optimization: Temperature, induction time, and media composition

Purification approaches:

  • Affinity chromatography: Using His-tag, FLAG-tag, or other affinity tags

  • Solubilization strategies: Testing different detergents (DDM, LMNG, digitonin) or nanodiscs

  • Size exclusion chromatography: Further purifying the receptor after affinity purification

Researchers should note that the strategic approach used for OR51E2 might be applicable to OR5M9. OR51E2 was selected for study partly because of its expression in non-olfactory organs, suggesting easier expression in heterologous systems . If OR5M9 shares similar characteristics, it may be more amenable to recombinant expression.

How can researchers validate the specificity and sensitivity of OR5M9 antibodies?

Validating antibody specificity and sensitivity is critical for ensuring reliable research results. For OR5M9 antibodies such as PACO04196, several validation methods should be employed:

Positive and negative controls:

  • Positive control: Tissues or cells known to express OR5M9

  • Negative control: Tissues not expressing OR5M9 or knockout/knockdown models

  • Competing peptide control: Pre-incubation with the immunizing peptide should abolish signal

Multiple detection methods validation:
The OR5M9 antibody should be validated across multiple applications as appropriate:

ApplicationValidation ApproachExpected Results
Western BlotDetect single band at predicted MW (~35-40 kDa)Clear, specific band at correct size
ImmunofluorescenceCompare with mRNA expression patternConsistent localization patterns
ELISATitration curve with recombinant proteinLinear dose-response in working range

Cross-reactivity testing:

  • Test against closely related olfactory receptors

  • Perform peptide array analysis to confirm epitope specificity

  • Validate in overexpression systems with tagged OR5M9

Reproducibility assessment:

  • Compare different antibody lots

  • Test in multiple cell lines/tissues

  • Validate results with orthogonal methods (e.g., mass spectrometry)

For the OR5M9 Antibody (PACO04196), it has been affinity-purified from rabbit antiserum using epitope-specific immunogen and validated for applications including ELISA, Western blotting (recommended dilution 1:500-1:2000), and immunofluorescence (recommended dilution 1:200-1:1000) . Researchers should still perform their own validation in their specific experimental context.

What cellular assays are most appropriate for measuring OR5M9 activation?

Multiple cellular assays can be employed to measure OR5M9 activation, each with distinct advantages:

Calcium imaging assays:
This approach measures intracellular calcium levels as an indicator of OR5M9 activation. When OR5M9 binds an odorant, it activates the Gαolf protein, leading to adenylyl cyclase activation, cAMP production, and opening of cyclic nucleotide-gated channels, resulting in calcium influx that can be measured with fluorescent calcium indicators.

cAMP assays:
These assays directly measure the second messenger cAMP produced upon OR5M9 activation:

cAMP Assay TypeFormatSensitivityThroughput
ELISA-basedEndpointMediumLow-Medium
FRET-basedReal-timeHighMedium-High
Luciferase reporterEndpoint/Real-timeHighHigh
GloSensorReal-timeVery HighHigh

Luciferase reporter assays:
A CRE-driven luciferase reporter system can be used, where OR5M9 activation leads to cAMP production, which activates protein kinase A (PKA), leading to CREB phosphorylation and subsequent luciferase expression.

Electrophysiology:
Patch-clamp recording can directly measure electrical currents resulting from ion channel opening following OR5M9 activation, providing high temporal resolution but lower throughput.

Bioluminescence resonance energy transfer (BRET):
This technique can measure conformational changes in OR5M9 or its interaction with downstream signaling partners following odorant binding.

For all assays, several experimental considerations are crucial:

  • Include positive controls (known OR5M9 agonists if available) and negative controls

  • Perform dose-response experiments with varying odorant concentrations

  • Account for potential background activity of the expression system

  • Optimize transfection efficiency and receptor expression levels

  • Consider co-expression of accessory proteins that may enhance receptor functioning

These methodological approaches enable comprehensive characterization of OR5M9 activation profiles in response to various odorants.

How should researchers interpret concentration-dependent activation profiles of OR5M9?

Interpreting concentration-dependent activation profiles of OR5M9 requires careful analysis and consideration of several parameters:

Key parameters to analyze:

  • EC50 (half-maximal effective concentration): The odorant concentration producing 50% of the maximal response, reflecting receptor affinity.

  • Emax (maximal effect): The maximum response achievable, indicating receptor efficacy.

  • Hill coefficient: Reflects cooperativity in ligand binding; values significantly different from 1 suggest complex binding mechanisms.

  • Threshold concentration: The minimum concentration required to elicit a detectable response.

  • Dynamic range: The concentration range over which the receptor exhibits a graded response.

Recommended analysis approach:

  • Plot dose-response curves using a semi-logarithmic scale (log[odorant] vs. response)

  • Fit data to appropriate models (typically sigmoidal dose-response)

  • Calculate confidence intervals for all parameters

  • Compare parameters across different experimental conditions or odorants

For proper interpretation, consider that similar olfactory receptors like OR5M3 and OR8D1 have exhibited distinct concentration-dependent activation profiles in response to flavoring compounds like furaneol and sotolone . The analysis of such concentration-dependent profiles has revealed receptor-specific activation patterns important for odor discrimination.

Analysis ParameterInterpretationExample
Low EC50 valueHigh affinity bindingEC50 = 1 μM indicates higher affinity than EC50 = 10 μM
High Emax valueHigh efficacySuggests full receptor activation
Variable Hill coefficientsComplex binding mechanicsMay indicate multiple binding sites or cooperative effects
Rightward shift in curveDecreased potencyMay indicate competitive antagonism
Reduced EmaxReduced efficacyMay indicate partial agonism or receptor desensitization

When interpreting OR5M9 activation data, researchers should remember that concentration-dependent responses provide critical information about receptor-ligand interactions and can help establish the receptor's odor response profile.

How can researchers distinguish between specific and non-specific binding in OR5M9 studies?

Distinguishing between specific and non-specific binding is crucial for accurate characterization of OR5M9-ligand interactions. Several methodological approaches can help researchers make this distinction:

Competition assays:

  • Conduct displacement studies with known OR5M9 ligands at various concentrations

  • Specific binding will show concentration-dependent displacement

  • Non-specific binding typically remains constant regardless of competitor concentration

Saturation binding analysis:

  • Perform binding studies with increasing concentrations of labeled ligands

  • Plot total binding, non-specific binding, and specific binding curves

  • Specific binding will saturate at high concentrations, while non-specific binding typically increases linearly

Controls and validation:

  • Negative controls: Test binding in cells not expressing OR5M9

  • Mutant controls: Use OR5M9 mutants with altered binding sites

  • Cross-receptor controls: Compare binding with other olfactory receptors

Scatchard analysis methodology:

  • Convert saturation binding data to a Scatchard plot (Bound/Free vs. Bound)

  • Linear Scatchard plots suggest a single binding site

  • Non-linear plots may indicate multiple binding sites or cooperativity

ParameterSpecific BindingNon-specific Binding
SaturationReaches plateauContinues to increase linearly
AffinityHigh (nM-μM range)Low (mM range)
CompetitionDisplaced by unlabeled ligandsMinimal displacement
Temperature dependencyMore sensitive to temperatureLess sensitive to temperature
KineticsAssociation/dissociation follows defined kineticsRapid, non-specific kinetics

Studies of other olfactory receptors like OR51E2 have shown that specific binding involves defined interactions, including polar interactions (hydrogen and ionic bonds) and non-specific hydrophobic interactions within an enclosed binding pocket . Researchers should apply similar principles when studying OR5M9-ligand interactions.

What are the best practices for analyzing and reporting OR5M9 structure-function relationships?

Analyzing and reporting OR5M9 structure-function relationships requires a systematic approach to generate reliable and reproducible findings:

Structural analysis best practices:

  • Homology modeling validation:

    • Use multiple templates when building homology models

    • Validate models with Ramachandran plots, QMEAN, and other quality metrics

    • Compare with AlphaFold2 or RoseTTAFold predictions for consensus

  • Binding site characterization:

    • Identify key residues using multiple computational approaches

    • Categorize residues by function (hydrogen bonding, hydrophobic interaction, etc.)

    • Map conservation across related olfactory receptors

  • Dynamics analysis:

    • Perform molecular dynamics simulations at multiple timescales

    • Analyze conformational changes upon ligand binding

    • Identify water molecules in the binding pocket and their role

Functional analysis best practices:

  • Systematic mutagenesis:

    • Create single-point mutations at predicted interaction sites

    • Use alanine scanning to identify essential residues

    • Create chimeric receptors to identify functional domains

  • Activation profiling:

    • Test multiple ligand concentrations to generate complete dose-response curves

    • Use multiple functional assays to confirm findings

    • Compare activation parameters (EC50, Emax) across mutants

Reporting standards:

ElementRequirementsExample
Structural modelsProvide coordinates, template information, validation metrics"Homology model based on OR51E2 (PDB: XXXX), QMEAN score: 0.72"
Binding predictionsDetail docking parameters, scoring functions, validation"Molecular docking performed using AutoDock Vina with exhaustiveness=16"
Mutagenesis resultsReport primers, verification methods, expression levels"Mutations verified by Sanger sequencing; expression confirmed by Western blot"
Functional dataInclude raw data, statistical methods, replicates"n=3 independent experiments, each with technical triplicates"

Similar to the approach used for other olfactory receptors, researchers investigating OR5M9 should integrate structural insights with functional data to establish clear structure-function relationships . Combining techniques such as cryo-EM or computational structure prediction with molecular docking, dynamics simulations, and cellular experiments provides a comprehensive view of OR5M9 function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.