Recombinant Human Olfactory receptor 5T2 (OR5T2)

What is Olfactory Receptor 5T2 and what is its classification within the human olfactory receptor family?

Olfactory Receptor 5T2 (OR5T2) is a member of the human olfactory receptor family, which belongs to class A G-protein-coupled receptors. These receptors constitute the largest transmembrane protein family in the human genome and play a crucial role in detecting odorant molecules in the surrounding environment . OR5T2 is specifically identified with the UniProt accession number Q8NGG2 and consists of 359 amino acids in its full-length form . Like other olfactory receptors, OR5T2 functions by binding to specific odorant molecules, which initiates signal transduction pathways leading to odor perception. Olfactory receptors are characterized by their varying ligand specificity profiles, with some responding to a broad range of odorants while others are activated by a limited number of structurally related compounds .

What is the amino acid sequence and structural characteristics of human OR5T2?

Human OR5T2 is a 359-amino acid protein with a specific sequence that defines its structural and functional properties. From the available data, a partial amino acid sequence of OR5T2 is: MSYSIYKSTVNIPLSHGVHSFCHNMNCNFMHIFKFVLDFNMKNVTEVTLFVLKGFTDNLELQTIFFFLFLAIYLFTLMGNLGLILVVIRDSQLHKPMYYFLSMLSSVDACYSSVITPNMLVDFTTKNKVISFLGCVAQVFLACSFGTTECFLLAAM . Structurally, OR5T2, like other olfactory receptors, is expected to feature seven transmembrane domains characteristic of G-protein-coupled receptors. These transmembrane regions form a pocket where odorant binding occurs. The protein likely exists in both monomeric and dimeric forms, similar to other characterized olfactory receptors . The tertiary structure of OR5T2 has not been definitively resolved through crystallography or NMR studies, presenting an opportunity for structural biology research in this area.

How does the recombinant expression of OR5T2 differ from its native expression?

Recombinant expression of OR5T2 involves engineering the protein with specific modifications to facilitate its production, purification, and functional analysis in non-native systems. In recombinant systems, OR5T2 is typically expressed with tags such as histidine (His) tags to enable affinity purification . While native OR5T2 is expressed in olfactory neurons with specific post-translational modifications and membrane environments, recombinant OR5T2 is produced in heterologous systems like E. coli or mammalian cell lines such as HEK293S cells, which have been successfully used for other olfactory receptors .

The key differences include: 1) Native expression occurs in specialized olfactory neurons with appropriate machinery for correct folding and localization, while recombinant expression may require optimization of conditions in heterologous systems; 2) Recombinant OR5T2 often includes epitope tags for detection and purification, altering the native sequence; 3) Expression levels are typically higher in engineered recombinant systems compared to native expression; and 4) The membrane composition and cellular environment differ significantly between native olfactory neurons and recombinant expression systems, potentially affecting receptor functionality and stability.

What expression systems are most effective for producing functional recombinant OR5T2 protein?

The choice of expression system significantly impacts the yield, functionality, and structural integrity of recombinant OR5T2. Based on research with similar olfactory receptors, both prokaryotic and eukaryotic expression systems have distinct advantages:

Mammalian Cell Expression Systems: HEK293S cells with tetracycline-inducible expression have proven effective for other olfactory receptors . This system allows for controlled expression and proper membrane integration. For OR5T2, a stable tetracycline-inducible HEK293S cell line with epitope tags (such as N-terminal FLAG and C-terminal rho1D4 tags) would facilitate both functional studies and purification processes .

Insect Cell Systems: Though not mentioned specifically in the search results for OR5T2, baculovirus-infected insect cells represent another viable option for olfactory receptor expression, offering a compromise between protein yield and post-translational modification capabilities.

The most effective approach appears to be mammalian expression systems for functional studies, as they provide the cellular machinery necessary for proper folding and post-translational modifications of membrane proteins like OR5T2.

What purification strategies yield the highest quality OR5T2 for structural and functional studies?

Purification of high-quality OR5T2 requires specialized strategies to maintain protein integrity while achieving suitable purity. Based on successful approaches with other olfactory receptors, a multi-step purification protocol is recommended:

Initial Solubilization: Carefully select detergents for membrane protein extraction that preserve OR5T2 structure and function. Mild detergents that have worked for other olfactory receptors should be considered.

Affinity Chromatography: Utilize the His-tag present on recombinant OR5T2 for initial purification via immobilized metal affinity chromatography (IMAC) . For dual-tagged constructs, anti-FLAG immunoaffinity purification has proven effective for other olfactory receptors .

Size Exclusion Chromatography: Further purify OR5T2 using gel filtration to separate monomeric and dimeric forms and remove aggregates. This technique has successfully resolved different oligomeric states of other olfactory receptors .

Quality Assessment: Verify proper folding of purified OR5T2 using circular dichroism analysis, which has been effective in confirming the structural integrity of other purified olfactory receptors .

This multi-step approach typically yields milligram quantities of purified receptor from large-scale cultures (e.g., sixty T175 flasks yielded approximately 1.6 mg monomeric and 1.1 mg dimeric forms of another olfactory receptor) , providing sufficient material for structural and functional analyses.

How can researchers assess the functional activity of recombinant OR5T2 in heterologous systems?

Functional assessment of recombinant OR5T2 in heterologous systems requires specific assays to evaluate ligand binding and signal transduction capabilities. The following methodologies are recommended based on successful approaches with other olfactory receptors:

Real-time cAMP Assays: Implement assays that measure changes in intracellular cAMP levels in response to potential OR5T2 ligands. This approach has been validated for assessing the functional activity of olfactory receptors in heterologous HEK293S cells .

Intrinsic Tryptophan Fluorescence Assay: Utilize this technique to quantify ligand binding to purified OR5T2. The method measures changes in tryptophan fluorescence upon ligand binding and has successfully determined binding affinities for other olfactory receptors in the micromolar range .

Calcium Imaging: Though not specifically mentioned in the search results, calcium flux assays using fluorescent calcium indicators represent another standard approach for functional assessment of olfactory receptors in heterologous systems.

Binding Affinity Determination: For purified OR5T2, determine ligand binding affinities through dose-response experiments, which typically reveal micromolar range affinities for olfactory receptors and their cognate odorants .

When conducting these functional assessments, it's crucial to include appropriate positive and negative controls and to validate results across multiple experimental replicates to ensure reliability.

How should researchers organize and manage experimental data from OR5T2 studies to ensure FAIR principles?

Effective management of experimental data from OR5T2 studies should follow FAIR principles (Findable, Accessible, Interoperable, Reusable) to maximize research value and reproducibility. The following structured approach is recommended:

Data Organization: Implement a systematic organization where each variable forms a column, each observation forms a row, and each table relates to a specific entity type (e.g., samples, analyses) . For OR5T2 studies, create separate tables for different experimental stages such as expression, purification, and functional assays, ensuring clear linking between tables via consistent identifiers.

Structural Metadata Definition: Define critical metadata for each dataset, including:

• Entity metadata that associates each data table with its key concept and establishes links between related tables

• Attribute metadata that describes each variable with its category (identifier, factor, quantitative, or qualitative), description, unit, and data type

Ontological Annotation: Annotate experimental terms with standardized definitions from relevant ontologies to ensure unambiguous interpretation. For OR5T2 research, consider using protein and receptor-specific ontologies from resources like AgroPortal .

Data Integration Tools: Utilize software like ODAM (Open Data for Access and Mining) that facilitates data integration across experimental stages through an API layer, enabling visualization, selective export, and model building .

Repository Selection: Choose data repositories that support API-based data retrieval and meet FAIR criteria, such as Dataverse, Dryad, FAIRDOMHub, FigShare, or Zenodo . Ensure the repository can appropriately handle both the experimental data and its structural metadata.

This approach ensures that OR5T2 research data remains interpretable and reusable by both humans and machines, facilitating meta-analyses and ensuring the long-term value of experimental results.

What statistical approaches are most appropriate for analyzing ligand binding data for OR5T2?

Analyzing ligand binding data for OR5T2 requires appropriate statistical methods to ensure accurate interpretation of results. The following approaches are recommended based on established practices in olfactory receptor research:

Dose-Response Curve Analysis: For quantitative binding assays such as intrinsic tryptophan fluorescence measurements , fit data to appropriate mathematical models (typically sigmoidal dose-response curves) to determine key parameters:

• EC50/IC50 values (concentration producing half-maximal response)

• Hill coefficients (indicating cooperativity)

• Bmax values (maximum binding capacity)

Scatchard Analysis: For equilibrium binding studies, transform binding data using Scatchard plots to determine dissociation constants (Kd) and binding site numbers.

Statistical Validation: Implement rigorous statistical testing including:

• ANOVA with appropriate post-hoc tests for comparing multiple conditions

• t-tests for paired comparisons

• Non-parametric alternatives when normality assumptions are not met

Replication and Power Analysis: Design experiments with sufficient replication based on power analysis to detect biologically meaningful effect sizes. For OR5T2 binding studies, a minimum of three independent biological replicates is typically necessary.

Data Visualization: Present data using informative visualizations including:

• Box plots showing distribution characteristics

• Scatter plots with error bars representing standard deviation or standard error

• Heat maps for comparing binding profiles across multiple ligands

When analyzing binding data for detergent-solubilized OR5T2, account for potential detergent effects on binding parameters by including appropriate controls and comparing results with membrane-embedded receptor when possible.

How do monomeric and dimeric forms of OR5T2 differ in their ligand binding properties and signaling capabilities?

The functional distinctions between monomeric and dimeric forms of OR5T2 represent an important area of investigation in olfactory receptor research. While specific data on OR5T2 oligomeric states is limited, findings from related olfactory receptors provide valuable insights:

Structural Organization: Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) analysis has demonstrated the presence of both monomeric and dimeric forms of olfactory receptors in detergent-solubilized preparations . For OR5T2, similar analytical approaches would likely reveal comparable oligomeric distributions.

Binding Kinetics Differences: The monomeric and dimeric forms likely exhibit distinct binding kinetics profiles. Intrinsic tryptophan fluorescence assays could reveal differences in:

• Association and dissociation rates

• Binding affinities (Kd values)

• Allosteric effects present in dimers but absent in monomers

Signaling Efficiency: The dimeric form may demonstrate enhanced signaling capabilities compared to monomers due to:

• Potential cooperative binding effects

• Increased stability in membrane environments

• More efficient coupling to G-proteins

Experimental Approach: To investigate these differences, researchers should:

• Separate monomeric and dimeric OR5T2 using size exclusion chromatography

• Conduct parallel functional assays with both forms

• Compare cAMP production efficiency between forms

• Assess stability differences using thermal shift assays

Understanding these differences has significant implications for structural biology studies, as the choice between monomeric and dimeric forms (approximately 1.6 mg and 1.1 mg yields respectively from large-scale expression) may impact crystallization success and functional interpretations.

What are the current challenges and approaches in determining the three-dimensional structure of OR5T2?

Determining the three-dimensional structure of OR5T2 presents significant challenges that researchers continue to address through evolving methodological approaches:

Key Challenges:

• Membrane protein crystallization difficulties due to hydrophobic surfaces

• Conformational heterogeneity inherent to G-protein-coupled receptors

• Low expression levels in many systems

• Protein stability issues during purification and crystallization attempts

Promising Approaches:

• Protein Engineering: Modify OR5T2 with stability-enhancing mutations and crystallization-promoting fusion proteins while maintaining native structure and function.

• Advanced Crystallization Methods: Implement lipidic cubic phase (LCP) crystallization, which has proven successful for other GPCRs. This method provides a membrane-mimetic environment that may better stabilize OR5T2 during crystallization.

• Cryo-Electron Microscopy (Cryo-EM): As an alternative to crystallography, cryo-EM has emerged as a powerful technique for membrane protein structure determination without requiring crystallization.

• NMR Spectroscopy: For specific domains or in combination with other techniques, NMR studies can provide valuable structural information, particularly regarding dynamics and ligand interactions .

• Computational Approaches: Employ homology modeling and molecular dynamics simulations based on related GPCR structures to predict OR5T2 structural features while experimental structures are being pursued.

The successful purification protocols developed for other olfactory receptors, yielding properly folded protein as confirmed by circular dichroism analysis , provide a foundation for structural studies of OR5T2. Through these integrated approaches, researchers are making progress toward resolving the three-dimensional structure of this olfactory receptor.

How can researchers identify and validate novel ligands for OR5T2 using computational and experimental approaches?

Identification and validation of novel ligands for OR5T2 require a strategic combination of computational prediction and experimental verification approaches:

Computational Ligand Discovery:

• Homology Modeling: Develop a structural model of OR5T2 based on known GPCR structures to create a virtual binding pocket for docking studies.

• Virtual Screening: Employ molecular docking to screen large compound libraries against the OR5T2 model, ranking compounds by predicted binding energies and interaction patterns.

• Pharmacophore Modeling: Generate pharmacophore models based on known olfactory receptor ligands to identify compounds with similar chemical features that may bind OR5T2.

• Machine Learning Approaches: Train algorithms on existing olfactory receptor-ligand data to predict potential OR5T2 ligands based on structural and physicochemical properties.

Experimental Validation Pipeline:

• Primary Screening: Test computationally predicted compounds using real-time cAMP assays in OR5T2-expressing heterologous cells to identify initial hits .

• Dose-Response Analysis: Determine EC50 values for promising compounds to quantify potency and efficacy at OR5T2.

• Binding Confirmation: Employ intrinsic tryptophan fluorescence assays with purified OR5T2 to directly measure ligand binding and determine binding affinities in the micromolar range .

• Structural Confirmation: Use techniques such as circular dichroism to confirm that ligand binding does not disrupt the properly folded state of OR5T2 .

• Functional Validation: Confirm that identified ligands trigger appropriate signaling cascades through downstream readouts such as calcium imaging or reporter gene assays.

This integrated approach maximizes efficiency by using computational methods to prioritize compounds for experimental testing, focusing laboratory resources on the most promising candidates while systematically expanding the known ligand profile of OR5T2.

Reference Properties of Recombinant OR5T2 Protein

Methodological Parameters for OR5T2 Functional Studies