Recombinant Human Olfactory receptor 5T3 (OR5T3)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of OR5T3

Structural Features
OR5T3 is a class A G protein-coupled receptor (GPCR) with seven transmembrane domains . Key characteristics include:

PropertyDetails
Gene NameOR5T3
UniProt IDQ8NGG3
Protein Length340 amino acids
Chromosomal LocationHuman chromosome 11p15.4
SubfamilyTetrapod-specific odorant receptors (Class O2)
Sequence MotifsConserved metal ion-binding sites in EC2 domain

The receptor's N-terminal region contains a rhodopsin-derived signal peptide (Rho-tag), while engineered epitope tags (e.g., FLAG, rho1D4) facilitate purification and detection .

Recombinant Expression and Purification

Expression Systems
OR5T3 is typically expressed in heterologous systems like HEK293 cells, often requiring chaperones (e.g., RTP1S, REEP1) for proper membrane localization . Key parameters include:

ParameterDetails
Host Cell LineHEK293S (tetracycline-inducible)
TagsN-terminal FLAG, C-terminal rho1D4
Purification MethodAnti-FLAG immunoaffinity + gel filtration
Yield~1.6 mg monomer, ~1.1 mg dimer per 60 T175 flasks
Storage-20°C or -80°C in Tris-based buffer with 50% glycerol

Functional Insights

Ligand Binding and Signaling
OR5T3 activation follows canonical GPCR pathways:

  1. Odorant binding induces conformational changes in transmembrane helices .

  2. Gα<sub>olf</sub> protein activation triggers cAMP production via adenylate cyclase .

  3. Calcium influx through cyclic nucleotide-gated ion channels depolarizes neurons .

Research Applications

Key Use Cases

  • Odorant Screening: Used in high-throughput luciferase assays to identify agonists/antagonists .

  • Structural Biology: Purified monomers/dimers enable crystallographic and NMR studies .

  • Disease Modeling: Investigated in neurodegenerative disorders linked to olfactory dysfunction .

Challenges

  • Low native expression levels require overexpression systems .

  • Ligand promiscuity complicates specificity studies .

Comparative Analysis with Other ORs

FeatureOR5T3OR5B3 (Homolog)
SubfamilyClass O2Class O2
Ligand SpecificityUnknownBroad (n-aliphatic compounds)
Expression TagsFLAG, rho1D410xHis-tag
Structural DataHomology models only Partial experimental data

Future Directions

  • Ligand Deorphanization: Advanced mutagenesis and computational docking to identify cognate odorants .

  • Drug Discovery: Targeting OR5T3 for metabolic or neurological therapies .

  • Sensor Development: Integration into biosensors for environmental or diagnostic applications .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please inform us of any specific tag requirements for prioritized development.
Synonyms
OR5T3; Olfactory receptor 5T3; Olfactory receptor OR11-178
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-340
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR5T3
Target Protein Sequence
MDSTFTGYNLYNLQVKTEMDKLSSGLDIYRNPLKNKTEVTMFILTGFTDDFELQVFLFLL FFAIYLFTLIGNLGLVVLVIEDSWLHNPMYYFLSVLSFLDACYSTVVTPKMLVNFLAKNK SISFIGCATQMLLFVTFGTTECFLLAAMAYDHYVAIYNPLLYSVSMSPRVYVPLITASYV AGILHATIHIVATFSLSFCGSNEIRHVFCDMPPLLAISCSDTHTNQLLLFYFVGSIEIVT ILIVLISCDFILLSILKMHSAKGRQKAFSTCGSHLTGVTIYHGTILVSYMRPSSSYASDH DIIVSIFYTIVIPKLNPIIYSLRNKEVKKAVKKMLKLVYK
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15297

KEGG: hsa:390154

STRING: 9606.ENSP00000305403

UniGene: Hs.553746

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the optimal expression system for recombinant OR5T3 protein?

When working with olfactory receptors like OR5T3, selecting an appropriate expression system is critical for obtaining functional protein. Cell-free expression systems have proven effective for olfactory receptor proteins, allowing for high-purity yields typically exceeding 85% as measured by SDS-PAGE analysis . This approach avoids many of the membrane protein expression challenges encountered in cellular systems while maintaining protein functionality.

For OR5T3 specifically, researchers should consider the structural similarities it shares with other olfactory receptors in the same family. The expression system selection should account for post-translational modifications that may affect receptor functionality. When designing your experimental protocol, incorporate control groups and variable manipulation to properly evaluate expression efficiency across different systems . This true experimental design approach enables reliable comparison between expression methods.

When optimizing expression conditions, systematically manipulate independent variables such as temperature, pH, and cofactor concentrations while measuring purity and functional activity as dependent variables. Document all extraneous variables that might influence results, including reagent lot numbers and equipment calibration status .

How should researchers validate OR5T3 protein functionality after expression?

Functionality validation for OR5T3 requires multiple complementary approaches. Since olfactory receptors belong to the G-protein coupled receptor 1 family, binding assays with known ligands constitute a primary validation method . Beyond binding assays, functional validation should include:

  • Structural integrity assessment through circular dichroism or thermal stability analysis

  • Downstream signaling pathway activation measurements

  • Ligand-dependent conformational change detection

When documenting validation procedures, clearly define your null and alternate hypotheses. For example, H0: "There is no difference in signaling activity between purified OR5T3 and negative controls," and H1: "Purified OR5T3 exhibits significant ligand-dependent signaling compared to negative controls" . This structured approach allows for statistical validation of experimental outcomes.

How can contradictions in OR5T3 binding data be systematically analyzed?

When analyzing olfactory receptor binding data, researchers frequently encounter contradictory results that require systematic evaluation. Contradictions in binding data can be conceptualized as impossible combinations of values in interdependent data items . For OR5T3 binding studies, implement a structured notation of contradiction patterns using parameters (α, β, θ), where:

  • α represents the number of interdependent binding data points

  • β indicates contradictory dependencies defined by domain experts

  • θ denotes the minimal number of Boolean rules needed to assess these contradictions

This approach allows researchers to handle multidimensional interdependencies within binding datasets systematically . For example, when OR5T3 binding data shows contradictions across multiple ligand interaction studies, organize the data contradictions into patterns that can be efficiently analyzed.

When implementing contradiction assessment, consider that the minimum number of Boolean rules might be significantly lower than the number of described contradictions . This optimization improves computational efficiency and clarifies the underlying patterns in seemingly contradictory binding data.

What experimental designs are most appropriate for OR5T3 ligand screening studies?

For ligand screening with OR5T3, researchers should implement factorial experimental designs that allow for systematic testing of multiple variables simultaneously. This approach enables evaluation of both main effects and interaction effects between different chemical structures and receptor activation .

When designing ligand screening experiments:

  • Clearly identify independent variables (ligand structures, concentrations) and dependent variables (binding affinity, downstream signaling)

  • Control extraneous variables that might confound results, such as temperature fluctuations or sample degradation

  • Implement randomization protocols to minimize systematic bias

  • Define appropriate control conditions, including negative controls (non-binding compounds) and positive controls (known ligands)

For comprehensive ligand screening, consider implementing adaptive experimental designs that allow modification of testing parameters based on preliminary results. This approach enables more efficient exploration of chemical space while maintaining scientific rigor . Document all experimental conditions meticulously to ensure reproducibility and facilitate meta-analysis across multiple studies.

How does OR5T3 sequence compare with other olfactory receptors?

OR5T3 belongs to the G-protein coupled receptor 1 family, sharing structural similarities with other olfactory receptors . When analyzing sequence relationships, researchers should examine conserved motifs across the olfactory receptor family while identifying unique regions that may confer ligand specificity to OR5T3.

Based on structural patterns observed in related receptors like OR5AL1, researchers can predict functional domains in OR5T3. Key features likely include:

  • Seven transmembrane domains characteristic of G-protein coupled receptors

  • N-terminal extracellular domain involved in ligand recognition

  • Intracellular C-terminal domain mediating G-protein interaction

  • Conserved amino acid residues essential for structural integrity

When conducting sequence analysis, implement systematic comparison methodologies that account for both primary sequence similarity and predicted structural homology. This dual approach provides deeper insight into functional conservation across the olfactory receptor family . Document sequence variations that might influence ligand specificity or signaling efficiency.

What methods are most effective for analyzing OR5T3 ligand-binding pocket structure?

Analysis of the OR5T3 ligand-binding pocket requires computational and experimental approaches. Based on established protocols for related olfactory receptors, researchers should implement:

  • Homology modeling based on related G-protein coupled receptor structures

  • Molecular dynamics simulations to predict binding pocket flexibility

  • Site-directed mutagenesis to validate computational predictions

  • Ligand docking studies to identify key interaction residues

When designing site-directed mutagenesis experiments, implement a true experimental design with control and experimental groups . For each mutant, clearly define hypotheses regarding expected changes in binding affinity or specificity. This structured approach allows for robust validation of computational predictions.

Document potential contradictions between computational predictions and experimental observations using the contradiction pattern notation (α, β, θ) to systematically analyze discrepancies . This methodology facilitates identification of model limitations and guides refinement of computational approaches.

How can researchers effectively analyze contradictions in OR5T3 signaling pathway data?

When analyzing OR5T3 signaling pathways, researchers frequently encounter contradictory data that requires systematic evaluation. Implementing a structured approach to contradiction analysis improves data interpretation reliability. For OR5T3 signaling pathway analysis, consider:

  • Documenting all interdependent signaling components (α parameter)

  • Identifying contradictory dependencies between pathway components (β parameter)

  • Determining minimal Boolean rules needed to assess these contradictions (θ parameter)

This approach allows for efficient identification of true contradictions versus apparent contradictions resulting from methodological differences or biological variability . When documenting signaling pathway data, clearly distinguish between contradictions that represent methodological issues versus those that might indicate novel biological mechanisms.

Implement visualization techniques that highlight contradictory data points while providing context for interpretation. This approach facilitates identification of patterns that might otherwise remain obscured in complex datasets . When reporting results, clearly document all contradiction analysis methodologies to ensure reproducibility.

What statistical approaches are recommended for analyzing OR5T3 binding kinetics data?

Analysis of OR5T3 binding kinetics requires statistical approaches that account for both experimental variability and underlying biological mechanisms. Researchers should implement:

  • Non-linear regression analysis for binding curve fitting

  • Comparison of different binding models (one-site, two-site, cooperative)

  • Statistical validation of model fit using appropriate criteria

  • Sensitivity analysis to evaluate parameter robustness

When designing statistical analysis protocols, clearly define null and alternative hypotheses for each analysis component . For example, when comparing binding models, the null hypothesis might state that a simpler model (e.g., one-site binding) adequately describes the data, while the alternative hypothesis proposes that a more complex model (e.g., two-site binding) provides significantly better fit.

For complex datasets, implement contradiction analysis to identify data points that deviate significantly from model predictions . This approach helps distinguish between experimental artifacts and biologically meaningful outliers. Document all statistical approaches thoroughly to ensure reproducibility and facilitate meta-analysis.

What are the key considerations for optimizing OR5T3 solubilization and purification?

Membrane protein solubilization and purification represent significant challenges in OR5T3 research. Based on protocols developed for similar olfactory receptors, researchers should consider:

  • Detergent selection based on compatibility with downstream applications

  • Buffer optimization to maintain protein stability

  • Purification strategy selection (affinity, ion exchange, size exclusion)

  • Quality control measures at each purification step

When optimizing solubilization conditions, implement a systematic experimental design that varies detergent type, concentration, and buffer components while measuring protein yield and functionality as dependent variables . This approach enables identification of optimal conditions while providing insight into factors affecting protein stability.

For purification protocol development, consider implementing a one-group pretest-posttest design to measure protein purity and activity before and after each purification step . While this approach has limitations, it provides valuable information about the impact of each purification stage on protein quality. Document all protocol parameters meticulously to ensure reproducibility.

How should researchers approach troubleshooting low-yield OR5T3 expression?

When encountering low-yield OR5T3 expression, researchers should implement a systematic troubleshooting approach based on experimental design principles:

  • Identify potential independent variables affecting expression (temperature, induction parameters, media composition)

  • Develop testable hypotheses regarding their impact on protein yield

  • Design controlled experiments to evaluate each variable systematically

  • Implement controls that allow distinction between expression and purification issues

When documenting troubleshooting experiments, clearly define research questions and formulate specific hypotheses for each variable tested . For example, "Lowering expression temperature from 37°C to 18°C will increase soluble OR5T3 yield by reducing inclusion body formation."

Analyze troubleshooting data for potential contradictions that might indicate complex interactions between experimental parameters . This approach helps identify non-obvious relationships between variables that might affect expression efficiency. Document all troubleshooting approaches thoroughly to build institutional knowledge and improve protocol robustness.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.