Recombinant Human Olfactory receptor 5V1 (OR5V1)-VLPs

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of OR5V1-VLPs

OR5V1-VLPs combine two key components:

  • OR5V1: A 321-amino acid olfactory receptor (UniProt ID: Q9UGF6) with seven transmembrane domains . Its recombinant form retains structural integrity when expressed in E. coli or HEK293 systems, as confirmed by SDS-PAGE (>85% purity) .

  • VLP Scaffold: Typically derived from non-infectious viral structural proteins (e.g., HBV core or bacteriophage QB), enabling high-density antigen display .

PropertyOR5V1 ComponentVLP Component
Molecular Weight42.1 kDa 20–200 nm (particle)
Expression SystemHEK293/E. coli Pichia pastoris/plants
Functional DomainsOdorant-binding siteSelf-assembling capsid

Production and Formulation Challenges

Key steps in OR5V1-VLP synthesis involve:

  1. Genetic Fusion: OR5V1 coding sequences (NCBI Gene ID: 81696) are inserted into VLP structural genes via plasmid vectors .

  2. Expression Optimization:

    • Bacterial systems (E. coli) require codon optimization and refolding protocols due to OR5V1’s transmembrane complexity .

    • Eukaryotic systems (HEK293) achieve proper glycosylation but face lower yields .

  3. Purification: Tris-based buffers with 50% glycerol maintain stability during storage at -20°C .

Critical Issues:

  • Only 18/37 tested ORs showed stable copy-number variation in human populations , complicating universal VLP designs.

  • Plant-based VLP systems (Nicotiana benthamiana) enable oral delivery but risk pepsin degradation in gastric environments .

Immunogenicity and Therapeutic Applications

While no clinical trials directly target OR5V1-VLPs, analogous platforms demonstrate:

Vaccine Development

VLP PlatformAntigenAdjuvantImmune Response
HBV coreHPV E7 peptideNoneTumor suppression
RHDVCpG oligonucleotideDEC205 targetingEnhanced CD8+ T cells

OR5V1-VLPs could theoretically enhance mucosal immunity through intranasal delivery, leveraging OR5V1’s native expression in nasal epithelium .

Odorant Screening

HEK293 cells expressing OR5V1 show calcium flux responses to micromolar helional concentrations . Incorporating OR5V1 into VLPs might enable high-throughput odorant screening via:

  • Fluorescence resonance energy transfer (FRET) biosensors

  • GCaMP6f calcium indicators in arrayed microwells

Research Gaps and Future Directions

  1. Structural Resolution: No cryo-EM data exists for OR5V1-VLP complexes.

  2. Delivery Optimization: Current VLP doses for mucosal immunity require 10× higher concentrations than parental routes .

  3. Stability Metrics: Acid resistance testing (simulated gastric fluid pH 1.5–3.5) remains unvalidated for OR5V1-VLPs .

Product Specs

Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4
Form
Lyophilized powder
Note: We will default ship it in lyophilized form with normal blue ice packs. However, if you require shipping in liquid form, it needs to be shipped with dry ice. Please communicate with us in advance, as extra fees for dry ice and a dry ice box will be charged.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributor for specific delivery times.
Note: Delivery time may vary depending on the purchase method or location. Please contact your local distributor for specific delivery times.
Notes
Repeated freezing and thawing is not recommended. Upon receipt, store the protein at -20°C/-80°C and avoid repeated freezing and thawing, as this can affect protein activity.
Shelf Life
Shelf life is dependent on various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
C-terminal 10xHis-tagged
If you have a specific tag type in mind, please inform us and we will investigate the feasibility of development.
Synonyms
OR5V1; Olfactory receptor 5V1; Hs6M1-21; Olfactory receptor OR6-26
Datasheet & Coa
Please contact us to get it.
Expression Region
1-321aa
Research Area
Neuroscience
Source
Mammalian cell
Species
Homo sapiens (Human)
Target Names
OR5V1
Target Protein Sequence
MERKNQTAITEFIILGFSNLNELQFLLFTIFFLTYFCTLGGNILIILTTVTDPHLHTPMYYFLGNLAFIDICYTTSNVPQMMVHLLSKKKSISYVGCVVQLFAFVFFVGSECLLLAAMAYDRYIAICNPLRYSVILSKVLCNQLAASCWAAGFLNSVVHTVLTFCLPFCGNNQINYFFCDIPPLLILSCGNTSVNELALLSTGVFIGWTPFLCIVLSYICIISTILRIQSSEGRRKAFSTCASHLAIVFLFYGSAIFTYVRPISTYSLKKDRLVSVLYSVVTPMLNPIIYTLRNKDIKEAVKTIGSKWQPPISSLDSKLTY
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 13972

KEGG: hsa:81696

STRING: 9606.ENSP00000366356

UniGene: Hs.666316

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OR5V1 and what is its normal expression pattern?

OR5V1 (Olfactory Receptor Family 5 Subfamily V Member 1) is a G protein-coupled receptor primarily expressed in olfactory tissue where it contributes to odor perception. Research has demonstrated that OR5V1 is normally expressed only in testes and nasal tissue . Like other olfactory receptors, OR5V1 belongs to the G protein-coupled receptor family that transduces chemical signals into cellular responses. Understanding its typical expression pattern is essential for contextualizing its aberrant expression in pathological conditions.

What pathological conditions show altered OR5V1 expression?

Current research indicates that OR5V1 is significantly over-expressed in specific solid cancers, particularly liver and renal cancers . Additionally, genetic variations in the OR5V1 gene have been associated with autism spectrum disorder, as demonstrated by exome-wide analysis studies. Specifically, the single nucleotide polymorphism rs2073149 in the OR5V1 gene shows significant association (p = 4.30 × 10^-5) with autism spectrum disorder . This dual involvement in both cancer biology and neurodevelopmental disorders makes OR5V1 a particularly interesting research target across multiple disciplines.

Why would researchers use VLP technology for studying OR5V1?

Virus-Like Particles (VLPs) provide an excellent platform for studying membrane proteins like OR5V1 because they mimic the natural lipid bilayer environment while providing a stable, uniform presentation of the protein. VLPs allow researchers to:

  • Present OR5V1 in its native conformation with proper post-translational modifications

  • Generate high-density display of the receptor for enhanced sensitivity in binding studies

  • Develop immunization strategies for antibody production against conformational epitopes

  • Create standardized reagents for reproducible research across different laboratories

This approach is particularly valuable for G protein-coupled receptors like OR5V1, which are notoriously difficult to study using traditional recombinant protein approaches due to their multiple transmembrane domains.

What expression systems are optimal for producing recombinant OR5V1?

Based on similar olfactory receptor studies, researchers should consider these expression systems when producing recombinant OR5V1:

Expression SystemAdvantagesLimitationsBest For
Cell-free systemsRapid production, avoids toxicity issues, allows production of proteins toxic to living cellsLimited post-translational modifications, lower yieldsInitial screening, structural studies
Mammalian cells (HEK293, CHO)Native folding, complete post-translational modificationsHigher cost, longer production timeFunctional studies, antibody production
Insect cells (Sf9, Hi5)High expression levels, eukaryotic processingGlycosylation patterns differ from humanLarge-scale production
Yeast (P. pastoris)High density cultures, eukaryotic processingHyperglycosylationCost-effective scale-up

Cell-free expression systems have shown particular promise for olfactory receptors, providing ≥85% purity for similar G protein-coupled receptors in the olfactory family . When designing your expression strategy, consider the downstream application requirements and whether native conformation or specific post-translational modifications are essential.

How can researchers verify proper folding and functionality of recombinant OR5V1?

Verifying proper folding and functionality of recombinant OR5V1 requires multiple complementary approaches:

  • Biochemical characterization: SDS-PAGE analysis under reducing and non-reducing conditions to assess protein integrity and potential oligomerization states .

  • Conformational antibody binding: If available, use conformation-specific antibodies derived from B cells isolated from ovarian tumors, as these recognize the native protein conformation .

  • Ligand binding assays: Employ fluorescent or radioactively labeled known ligands to verify receptor functionality.

  • Calcium flux or cAMP assays: Measure second messenger responses upon ligand binding in cellular systems expressing the recombinant receptor.

  • Circular dichroism spectroscopy: Assess secondary structure composition to confirm proper folding, particularly important for multi-transmembrane proteins like OR5V1.

Combining these methods provides a comprehensive assessment of both structural integrity and functional activity of your recombinant OR5V1 preparation.

How can OR5V1-targeting CAR-T cells be developed for cancer immunotherapy?

Development of OR5V1-targeting Chimeric Antigen Receptor (CAR)-T cells represents an advanced application of OR5V1 research with potential therapeutic implications. The process involves:

  • Antibody generation: Isolate and immortalize B cells from patients with OR5V1-expressing tumors, particularly from ovarian carcinomas with tertiary lymphoid structures .

  • scFv development: Extract the genetic sequence coding for the single-chain variable fragment (scFv) that specifically recognizes OR5V1.

  • CAR construction: Create a chimeric antigen receptor by fusing the OR5V1-specific scFv with costimulatory domains (CD28 or 4-1BB) and CD3ζ signaling domain.

  • T cell engineering: Transduce primary human T cells with the CAR construct using viral vectors.

  • Functional validation: Test the CAR-T cells against OR5V1-expressing cancer cells in vitro and in xenograft models.

This approach leverages the tumor-specific expression of OR5V1 in liver and renal cancers while sparing normal tissues, as OR5V1 expression is normally limited to testes and nasal tissue . This restricted expression pattern makes OR5V1 an attractive target for immunotherapy approaches.

What genetic variations in OR5V1 are associated with autism spectrum disorder and how can they be studied?

Research has identified significant associations between OR5V1 genetic variations and autism spectrum disorder. Key findings include:

SNP IDChromosomePositionMinor AlleleMAFP-valueOdds Ratio (95% CI)Case/Control Frequencies
rs2073149629,365,423A0.4934.30 × 10^-54.89 (2.21-10.82)0.750/0.380

Additional risk haplotypes involving OR5V1 include combinations with OR12D2 variations .

To study these variations, researchers should consider:

  • Genotyping technologies: Use next-generation sequencing or SNP arrays to identify OR5V1 variants in patient cohorts.

  • Functional characterization: Employ reporter gene assays to assess the impact of these variants on protein expression and function.

  • Transcriptional regulation analysis: Investigate whether variants affect binding of transcription factors, similar to methodologies used for other olfactory receptors like OR51B5 .

  • Animal models: Develop knock-in models expressing human OR5V1 variants to assess behavioral and developmental impacts.

These approaches can help elucidate the mechanistic relationship between OR5V1 variations and autism spectrum disorder pathophysiology.

How can researchers develop specific antibodies against OR5V1 for research applications?

Developing specific antibodies against OR5V1 presents unique challenges due to its multi-transmembrane domain structure. A proven methodology includes:

  • Patient-derived B cells: Isolate B cells from freshly dissociated advanced serous ovarian carcinomas with tertiary lymphoid structures through IRB-approved protocols .

  • B cell activation and immortalization: Activate isolated B cells with CD40 agonists plus IL-21 and immortalize using EBV .

  • Antibody screening: Purify IgG from immortalized B cells and screen for OR5V1 specificity using proteome arrays containing >80% of the human proteome .

  • Validation: Confirm antibody specificity using Western blotting, immunohistochemistry, and flow cytometry against OR5V1-expressing and non-expressing cell lines.

  • scFv conversion: Clone the variable regions from high-affinity antibodies to create single-chain variable fragments for research applications.

This methodology leverages the natural immune response against tumor-associated OR5V1, potentially yielding antibodies with superior specificity and affinity compared to traditional immunization approaches.

What approaches can be used to study OR5V1 transcriptional regulation?

Understanding transcriptional regulation of OR5V1 provides insights into both its normal expression patterns and dysregulation in pathological conditions. Based on methodologies used for other olfactory receptors, researchers should consider:

  • Promoter analysis: Examine 2,000 base pairs upstream of the transcription start site through deletion analysis to identify the core promoter region .

  • Luciferase reporter assays: Clone promoter fragments into reporter plasmids to assess activity with various transcription factors .

  • Site-directed mutagenesis: Introduce specific mutations in putative transcription factor binding sites to confirm regulatory elements .

  • Chromatin immunoprecipitation (ChIP): Identify transcription factors that bind to the OR5V1 promoter in vivo using ChIP-qPCR .

  • Electrophoretic mobility shift assay (EMSA): Confirm direct binding of identified transcription factors to OR5V1 promoter sequences .

This methodological approach has successfully identified TBX transcription factors as regulators of other olfactory receptors, suggesting similar mechanisms may control OR5V1 expression .

How can researchers address challenges in producing functional OR5V1-VLPs?

Common challenges in producing functional OR5V1-VLPs include poor expression, improper folding, and low incorporation into VLPs. Researchers should consider these methodological solutions:

  • Codon optimization: Optimize the OR5V1 gene sequence for the expression system to enhance translation efficiency.

  • Fusion partners: Incorporate solubility-enhancing tags (MBP, SUMO) or fluorescent proteins to monitor expression and facilitate purification.

  • Lipid composition: Systematically test different lipid compositions for VLP formation to identify optimal environments for OR5V1 stability.

  • Detergent screening: Test a panel of mild detergents (DDM, LMNG, GDN) for solubilization while maintaining native protein conformation.

  • Temperature modulation: Lower expression temperature (16-20°C) to slow protein synthesis and facilitate proper folding.

Successful production of similar G-protein coupled receptors has been achieved using cell-free expression systems with purities ≥85% , suggesting this approach may be valuable for OR5V1 as well.

How should researchers interpret contradictory data regarding OR5V1 function in different tissues?

When encountering contradictory data regarding OR5V1 function across different experimental systems or tissues, consider these analytical approaches:

  • Context-dependent signaling: Assess whether OR5V1 couples to different G proteins in different cellular contexts, leading to diverse downstream effects.

  • Expression level variations: Quantify receptor expression levels across experimental systems, as function may be concentration-dependent.

  • Post-translational modifications: Evaluate glycosylation, phosphorylation, and other modifications that may differ between expression systems.

  • Interacting proteins: Identify tissue-specific interacting partners that may modulate receptor function.

  • Experimental validation: Design experiments with appropriate controls that can directly address contradictions, including knockout/knockdown studies.

Remember that olfactory receptors like OR5V1 can have context-dependent functions, as evidenced by their roles in both olfactory perception and processes like collagen synthesis in non-olfactory tissues .

What are promising applications of OR5V1 research beyond cancer immunotherapy?

Emerging research suggests several promising directions for OR5V1 research:

  • Neurodevelopmental disorders: Further investigate the mechanistic link between OR5V1 variants and autism spectrum disorder, potentially revealing novel therapeutic targets .

  • Diagnostic biomarkers: Explore OR5V1 expression or antibodies against OR5V1 as potential biomarkers for early detection of liver and renal cancers .

  • Drug discovery: Use OR5V1-VLPs in high-throughput screening to identify novel ligands with potential therapeutic applications.

  • Olfactory system development: Study the role of OR5V1 in the development and organization of the olfactory system.

  • Tissue-specific functions: Investigate potential functions of OR5V1 in non-olfactory tissues where ectopic expression occurs, similar to other olfactory receptors that regulate processes like collagen synthesis in skin .

These diverse applications highlight the multidisciplinary potential of OR5V1 research beyond its most established role in cancer biology.

How might single-cell technologies advance our understanding of OR5V1 biology?

Single-cell technologies offer unprecedented opportunities to understand OR5V1 biology:

  • Single-cell RNA sequencing: Profile rare OR5V1-expressing cells within heterogeneous tissues to identify co-expressed genes and potential signaling networks.

  • Spatial transcriptomics: Map OR5V1 expression in tissue contexts while preserving spatial information about cellular neighborhoods and microenvironments.

  • CyTOF and spectral flow cytometry: Analyze OR5V1 protein expression alongside dozens of other proteins to identify correlations with cellular states.

  • Single-cell ATAC-seq: Examine chromatin accessibility at the OR5V1 locus to understand epigenetic regulation in different cell types.

  • Single-cell proteomics: Detect post-translational modifications and protein interactions of OR5V1 at the single-cell level.

These technologies will help resolve conflicting data from bulk analyses and reveal cell state-dependent functions of OR5V1 that may explain its diverse roles in development, olfaction, and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.