Recombinant Human Olfactory receptor 5W2 (OR5W2)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression Systems

OR5W2 is produced in heterologous systems to enable large-scale studies:

Escherichia coli Expression

  • Vector: pET-based plasmids with T7 promoters

  • Tags: N-terminal His tag for affinity chromatography

  • Yield: >90% purity via SDS-PAGE; stored in Tris/PBS buffer with 6% trehalose

  • Advantages: Cost-effective, high yield (~1–2 mg per purification batch)

Functional Challenges

  • Requires chaperones (e.g., RTP1/2) for proper folding in mammalian systems, as noted in studies of other olfactory receptors .

  • OR5W2’s detergent-solubilized form retains structural integrity, as confirmed by circular dichroism .

Functional Insights

While OR5W2’s exact ligands are uncharacterized, its mechanism aligns with class A GPCRs:

  1. Ligand Binding: Broadly tuned to hydrophobic odorants .

  2. Signal Transduction:

    • Odorant binding activates Gα<sub>olf</sub> proteins.

    • Triggers cAMP cascade, depolarizing olfactory neurons .

  3. Metal Ion Dependence: Copper or zinc ions may enhance sensitivity to sulfur-containing compounds, as seen in homologous receptors .

Purification and Characterization

MethodProtocol
Affinity ChromatographyImmobilized metal-ion (Ni-NTA) for His-tagged OR5W2
Size Exclusion ChromatographySeparates monomeric (~36 kDa) and dimeric forms
Activity AssaysCalcium imaging or cAMP luciferase reporter systems (not yet reported)

Research Applications

  • Deorphanization: High-throughput screening in databases like M2OR to identify ligands .

  • Structural Studies: Molecular dynamics simulations using conserved GPCR motifs .

  • Disease Links: Potential role in neurodegenerative amyloidal pathologies .

Challenges and Future Directions

  • Ligand Identification: Requires advanced assays like intrinsic tryptophan fluorescence or cryo-EM .

  • Stabilization: Improved detergents or nanodiscs for structural resolution .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have readily available. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your requests to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR5W2; OR5W2P; OR5W3P; Olfactory receptor 5W2; Olfactory receptor 5W3; Olfactory receptor OR11-155
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR5W2
Target Protein Sequence
MDWENCSSLTDFFLLGITNNPEMKVTLFAVFLAVYIINFSANLGMIVLIRMDYQLHTPMY FFLSHLSFCDLCYSTATGPKMLVDLLAKNKSIPFYGCALQFLVFCIFADSECLLLSVMAF DRYKAIINPLLYTVNMSSRVCYLLLTGVYLVGIADALIHMTLAFRLCFCGSNEINHFFCD IPPLLLLSRSDTQVNELVLFTVFGFIELSTISGVFISYCYIILSVLEIHSAEGRFKALST CTSHLSAVAIFQGTLLFMYFRPSSSYSLDQDKMTSLFYTLVVPMLNPLIYSLRNKDVKEA LKKLKNKILF
Uniprot No.

Target Background

Function
Odorant receptor.
Gene References Into Functions
  1. Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 20379614
Database Links

HGNC: 15299

KEGG: hsa:390148

STRING: 9606.ENSP00000342448

UniGene: Hs.554526

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfactory Receptor 5W2 and what is its role in human physiology?

Olfactory Receptor 5W2 (OR5W2), also known as OR5W3 or OR11-155, is a member of the G-protein coupled receptor 1 family and functions as a key component in the olfactory system. Like other olfactory receptors, OR5W2 interacts with odorant molecules in the nose to initiate neuronal responses that ultimately lead to the perception of smell. It is a 310 amino acid multi-pass membrane protein encoded by a gene located on human chromosome 11q11 . Olfactory receptors collectively form the largest gene family in the human genome, highlighting their evolutionary significance in environmental sensing and chemical perception .

What are the optimal conditions for reconstituting lyophilized recombinant OR5W2 protein?

For optimal reconstitution of lyophilized recombinant OR5W2 protein, the following methodology is recommended:

  • Centrifuge the vial briefly before opening to bring contents to the bottom.

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% (with 50% being standard) to improve stability.

  • Aliquot the reconstituted protein for long-term storage at -20°C/-80°C to avoid repeated freeze-thaw cycles.

  • For working solutions, store aliquots at 4°C for up to one week .

This methodology maximizes protein stability and activity while minimizing degradation that can occur through repeated freezing and thawing cycles, which is particularly important for membrane proteins like olfactory receptors that can be structurally sensitive.

What detection methods are most effective for studying OR5W2 expression and localization?

Multiple detection methods have proven effective for studying OR5W2 expression and localization, each with specific applications and advantages:

  • Western Blotting: Recommended starting dilution of 1:200 (range 1:100-1:1000) using antibodies specific to OR5W2. This technique effectively quantifies total protein expression levels in cell or tissue lysates .

  • Immunoprecipitation: Using 1-2 μg of antibody per 100-500 μg of total protein (1 mL of cell lysate) allows for isolation and enrichment of OR5W2 for further analysis .

  • Immunofluorescence: Starting dilution of 1:50 (range 1:50-1:500) enables visualization of subcellular localization of OR5W2 in fixed cells or tissue sections .

  • ELISA: Quantitative measurement of OR5W2 concentrations in tissue homogenates, cell lysates, and other biological fluids with a detection range of 0.156-10 ng/mL .

For all these methods, positive controls such as U-251-MG whole cell lysate have been validated for OR5W2 detection , providing a reliable reference point for experimental standardization.

How can heterologous expression of OR5W2 be optimized in mammalian cell lines?

Optimizing heterologous expression of OR5W2 in mammalian cell lines requires addressing several challenges specific to olfactory receptors. The following methodological approach has been shown to improve expression efficiency:

  • Use of specialized tags:

    • N-terminal tags such as Rho-tag (rhodopsin-derived signal peptide)

    • Lucy-tag or IL-6-Halo-tag, which demonstrate superior efficiency compared to standard Rho-tag for broader ranges of ORs

  • Co-expression with accessory proteins:

    • RTP1S (a C-terminal shortened version of RTP1) significantly enhances cell surface expression of ORs

    • Co-expression with non-OR GPCRs (e.g., β2-adrenergic receptor, M3 muscarinic acetylcholine receptor) to form heterodimers that improve trafficking to the cell surface

  • Improved signaling detection:

    • Co-expression of olfactory-specific G protein α GNAL/Gαolf, which has high affinity for ORs

    • Addition of Ric-8B, a chaperone of Gα protein

    • Implementation of GloSensor™ for highly sensitive cAMP detection

These optimizations have successfully increased the presentation of human ORs on the cell surface of HEK293 cells, enhancing the probability of identifying OR-odor interactions .

What considerations are important when interpreting OR5W2 response data from different assay systems?

When interpreting OR5W2 response data, researchers must account for assay-dependent bias, as different experimental systems can yield varying results. Key considerations include:

  • Cell line selection: Response profiles can differ significantly between cell types. For example, ORs expressed in prostate carcinoma cell lines (LNCaP) may identify ligands that are not recognized when the same ORs are expressed in HEK293 cells .

  • Assay methodology: The choice between calcium imaging, cAMP detection, or membrane potential measurements can impact sensitivity and kinetics of detected responses.

  • Time-course analysis: Human olfaction responds immediately after odor stimulation and adapts within minutes. Real-time measurements of intracellular Ca²⁺ influx provide more accurate representation of physiological OR responses than endpoint assays .

  • Expression system components: Co-expressed accessory proteins, tags, and signaling components can all influence the magnitude and specificity of OR responses.

  • Data normalization: Standardized controls and normalization methods are essential for comparing data across different experimental setups.

How can OR5W2 be incorporated into experimental designs for odor reconstitution and biosensor development?

Incorporating OR5W2 into experimental designs for odor reconstitution and biosensor development requires a multi-faceted approach:

  • Sensor platform selection:

    • Cell-based systems expressing OR5W2 with appropriate accessory proteins

    • Cell-free systems utilizing purified OR5W2 in artificial lipid bilayers or nanodiscs

    • Hybrid systems coupling OR5W2 to electronic detection methods

  • Signal amplification and detection:

    • For real-time applications, measuring intracellular Ca²⁺ influx is critical as it closely mimics the physiological response of olfactory sensory neurons (OSNs)

    • Coupling OR activation to bioluminescent or fluorescent reporters for enhanced sensitivity

    • Integration with CNG (cyclic nucleotide-activated channel) systems to replicate the membrane potential changes that occur in OSNs

  • Validation methodology:

    • Testing against known odorants with structural diversity

    • Comparing responses to native OSN recordings where available

    • Implementing controls to account for non-specific responses

  • Data analysis pipeline:

    • Machine learning algorithms to classify response patterns

    • Normalization methods to account for cell-to-cell variability

    • Statistical approaches to distinguish specific from non-specific binding events

This framework enables the development of OR5W2-based biosensors that can detect specific odorants with high sensitivity and selectivity, potentially advancing applications in environmental monitoring, food quality assessment, and medical diagnostics .

What experimental design considerations are critical when studying OR5W2 in comparison to other olfactory receptors?

When designing experiments to compare OR5W2 with other olfactory receptors, researchers should implement the following methodological considerations:

  • Controlled variable management:

    • Maintain consistent expression levels across different receptors by using equivalent vector systems and transfection methods

    • Implement control variables to prevent external factors from affecting results, such as temperature, pH, and cellular context

  • Statistical optimization:

    • Determine appropriate sample sizes for statistical power

    • Design points (unique combinations of independent variable settings) should be carefully selected based on the specific research questions

    • Consider factorial or fractional factorial designs to efficiently explore parameter space

  • Validity assurance:

    • Establish internal validity through appropriate controls and replication

    • Ensure external validity by testing across multiple cell lines or expression systems

    • Document methods with sufficient detail to enable replicability by other researchers

  • Comparative analysis framework:

    • Direct comparisons using standardized ligand panels

    • Dose-response relationships across concentration ranges

    • Kinetic measurements to capture temporal response differences

  • Deorphanization strategies:

    • When attempting to identify novel ligands, consider the demonstrated assay-dependent bias in OR responses

    • Implement parallel testing in multiple systems to increase confidence in identified ligand-receptor pairs

Implementing these design considerations will strengthen the scientific rigor of comparative studies involving OR5W2 and improve the reliability and interpretability of the resulting data .

What are the common challenges in achieving functional expression of OR5W2 and how can they be addressed?

Functional expression of OR5W2, like many olfactory receptors, presents several challenges that can be methodically addressed:

ChallengeCauseSolution Strategy
Poor surface expressionER retention due to misfoldingCo-express with RTP1S or other accessory proteins
Use optimized tags (Lucy-tag or IL-6-Halo-tag)
Co-express with non-OR GPCRs to form beneficial heterodimers
Weak signal transductionInefficient coupling to G proteinsCo-express with olfactory-specific Gαolf and Ric-8B chaperone
Use high-sensitivity detection systems (e.g., GloSensor)
Rapid desensitizationβ-arrestin mediated internalizationCo-express M3 muscarinic acetylcholine receptor to suppress β-arrestin 2-mediated internalization
Low specificity in ligand screeningNon-physiological expression systemCompare results across multiple cell lines
Validate findings using orthogonal assay methods
Protein degradationInstability of purified proteinAdd glycerol (5-50%) to storage buffer
Avoid repeated freeze-thaw cycles

Recent research has identified structural features of ORs that enable cell surface expression independent of RTPs, which may provide additional strategies for optimizing OR5W2 expression .

How should researchers interpret contradictory data when studying OR5W2 ligand interactions?

When confronted with contradictory data regarding OR5W2 ligand interactions, researchers should implement the following systematic approach:

  • Experimental context analysis:

    • Examine differences in expression systems used (e.g., HEK293 vs. LNCaP cells)

    • Consider the impact of accessory proteins present in different systems

    • Review detection methods employed (calcium imaging vs. cAMP accumulation)

  • Assay parameter evaluation:

    • Compare ligand concentrations used across studies

    • Assess exposure durations and measurement time points

    • Review buffer compositions and potential interfering compounds

  • Data normalization and comparison:

    • Re-analyze raw data using standardized normalization methods

    • Examine dose-response relationships rather than single-point measurements

    • Consider EC50 values rather than maximum response amplitudes

  • Validation experiments:

    • Conduct side-by-side comparisons using multiple assay formats

    • Implement structure-activity relationship analysis with related compounds

    • Perform competition studies with known ligands

  • Physiological relevance assessment:

    • Compare findings with native olfactory sensory neuron responses where available

    • Consider the cellular microenvironment differences between heterologous systems and native tissue

This methodological framework acknowledges that assay-dependent bias is a documented phenomenon in OR research, with ligands successfully identified in one cell line (e.g., LNCaP) sometimes not recognized when the same receptors are expressed in different cell lines (e.g., HEK293) .

What emerging technologies might enhance our understanding of OR5W2 structure-function relationships?

Several cutting-edge technologies show promise for advancing our understanding of OR5W2 structure-function relationships:

  • Cryo-electron microscopy (Cryo-EM): As resolution capabilities improve, Cryo-EM may soon enable direct visualization of OR5W2 structure in various conformational states, providing insights into ligand binding mechanisms and activation dynamics.

  • AI-powered structure prediction: Building on recent advances in protein structure prediction algorithms (e.g., AlphaFold2), specialized models trained on membrane protein datasets could generate increasingly accurate OR5W2 structural models.

  • Single-molecule fluorescence techniques: These approaches can reveal conformational changes in real-time, potentially elucidating the dynamics of OR5W2 activation upon ligand binding.

  • Nanobody development: Engineering specific nanobodies against OR5W2 could stabilize particular conformations, facilitating structural studies and providing tools for functional regulation.

  • Advanced microfluidic systems: Integration of OR5W2 expression systems with microfluidic technologies allows precise control over the temporal and spatial presentation of odorants, enabling more sophisticated analysis of receptor kinetics and adaptation.

  • Genome editing in native contexts: CRISPR-Cas9 editing of endogenous OR5W2 (e.g., with reporter tags) in olfactory sensory neurons could provide insights into physiological function that are difficult to obtain in heterologous systems.

These technological advances promise to bridge current knowledge gaps regarding the molecular mechanisms underlying OR5W2 odorant recognition and signal transduction.

How might research on OR5W2 contribute to understanding broader principles in GPCR signaling and evolution?

Research on OR5W2 offers unique opportunities to illuminate fundamental principles in GPCR biology:

  • Evolutionary insights: As part of the largest gene family in the genome, comparative studies of OR5W2 across species can reveal evolutionary pressures shaping GPCR diversification and specialization.

  • Ligand promiscuity mechanisms: Understanding how OR5W2 recognizes multiple structurally diverse odorants could reveal general principles about GPCR ligand binding pocket flexibility and selectivity.

  • Signal transduction diversity: Studies of OR5W2 coupling to different G proteins or alternative signaling pathways may uncover novel mechanisms of GPCR signaling diversity.

  • Receptor trafficking regulation: The unique challenges in OR5W2 surface expression provide a model system for studying general principles of GPCR quality control, trafficking, and membrane localization.

  • Allosteric modulation: Identifying compounds that modify OR5W2 responses to odorants could reveal new paradigms for allosteric regulation applicable to other GPCRs.

  • Heterodimer functionality: The documented formation of heterodimers between ORs and other GPCRs presents opportunities to study how receptor dimerization influences signaling properties across the GPCR superfamily.

By addressing these questions, OR5W2 research contributes not only to our understanding of olfaction but also to broader principles of GPCR biology with potential applications in drug discovery and development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.