Recombinant Human Olfactory receptor 6B3 (OR6B3)

Shipped with Ice Packs
In Stock

Description

Antibodies

  • Anti-OR6B3 Antibody (A18801):

    • Host: Rabbit polyclonal

    • Applications: Western blot (1:500–2,000), ELISA (1:5,000–20,000)

    • Immunogen: Synthetic peptide (amino acids 210–290 of human OR6B3)

    • Specificity: Validated in human tissue homogenates .

ELISA Kits

  • Human OR6B3 ELISA Kit (MBS7243217):

    • Detection range: 0.156–10 ng/mL

    • Sample types: Tissue homogenates, cell lysates, biological fluids

    • Sensitivity: Detects native OR6B3, not recombinant isoforms .

Functional Insights

While direct ligand specificity for OR6B3 remains uncharacterized, studies on homologous receptors provide context:

  • Signal transduction: Activation triggers Gα<sub>olf</sub>-mediated cAMP pathways, leading to calcium influx .

  • Tissue expression: Detected in olfactory epithelium, airway smooth muscle cells, and spermatozoa, suggesting roles beyond olfaction .

Challenges in OR6B3 Research

  • Low native expression: Requires overexpression systems for functional studies .

  • Ligand identification: No confirmed odorants due to limited deorphanization efforts .

Future Directions

  • Structural studies: Cryo-EM or crystallography to resolve ligand-binding mechanisms .

  • Pathophysiological roles: Investigate contributions to airway diseases or reproductive biology .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes and we will do our best to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. We recommend contacting your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, serving as a reference for your convenience.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles to maintain protein integrity.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you have specific tag preferences, please inform us, and we will prioritize developing the specified tag whenever possible.
Synonyms
OR6B3; OR6B3P; Olfactory receptor 6B3; Olfactory receptor OR2-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-331
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR6B3
Target Protein Sequence
MSGENVTRVGTFILVGFPTAPGLQYLLFLLFLLTYLFVLVENLAIILTVWSSTSLHRPMY YFLSSMSFLEIWYVSDITPKMLEGFLLQQKRISFVGCMTQLYFFSSLVCTECVLLASMAY DRYVAICHPLRYHVLVTPGLCLQLVGFSFVSGFTISMIKVCFISSVTFCGSNVLNHFFCD ISPILKLACTDFSTAELVDFILAFIILVFPLLATMLSYAHITLAVLRIPSATGCWRAFFT CASHLTVVTVFYTALLFMYVRPQAIDSRSSNKLISVLYTVITPILNPLIYCLRNKEFKNA LKKAFGLTSCAVEGRLSSLLELHLQIHSQPL
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15042

KEGG: hsa:150681

STRING: 9606.ENSP00000322435

UniGene: Hs.626616

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfactory Receptor 6B3 (OR6B3)?

OR6B3, also known as OR6B3P or Olfactory receptor OR2-2, is a full-length human olfactory receptor protein consisting of 331 amino acids with UniProt ID Q8NGW1 . While traditionally associated with olfaction, OR6B3 has been discovered to be ectopically expressed in various neuronal tissues, particularly in the human retina, trigeminal ganglia (TG), and dorsal root ganglia (DRG) . The protein represents an intriguing example of sensory receptors playing potential roles beyond their canonical functions, positioning it as a significant target for neurosensory research.

How is OR6B3 expressed across different human tissues?

OR6B3 shows a distinct expression pattern predominantly in neuronal tissues. Deep sequencing studies have confirmed high expression levels in the human retina with transcript per million (TPM) values of 43-57, making it the highest expressed olfactory receptor in this tissue . Additionally, OR6B3 can be detected in the trigeminal ganglia (TG) and dorsal root ganglia (DRG), but not in most other reference tissues examined . This expression pattern suggests that OR6B3 is predominantly a neuron-specific olfactory receptor, potentially serving specialized functions in sensory neurons beyond olfaction.

How should experiments be designed to accurately distinguish OR6B3 from its homologs?

Designing experiments to distinguish OR6B3 from homologs, particularly OR6B2 (which shares 95% sequence identity), requires a carefully controlled methodology . Begin by implementing a true experimental design with appropriate controls for confounding variables as outlined in standard experimental methodology . For RNA-based detection, design primers or probes targeting regions of sequence divergence between OR6B3 and OR6B2. When analyzing RNA-Seq data, employ stringent mapping quality thresholds and examine unique mapping reads at positions where sequences differ .

For protein-level detection, develop antibodies against peptide regions unique to OR6B3, and validate specificity using recombinant proteins of both OR6B3 and its homologs. Visualization tools like Integrative Genomics Viewer (IGV) can help confirm the predicted expression and validate identification of transcript isoforms including 5'UTR variants . These approaches enabled researchers to definitively determine that OR6B3, not OR6B2, is expressed in human retina despite their high sequence similarity.

What are effective methodologies for detecting OR6B3 expression at transcript and protein levels?

For comprehensive OR6B3 detection, employ multiple complementary approaches:

Transcript detection:

  • RT-PCR: Design primers spanning exon junctions and targeting unique regions of OR6B3 to distinguish from homologs. RT-PCR has successfully validated OR6B3 expression in retinal samples .

  • RNA-Seq: Deep sequencing with adequate coverage (>20 million reads per sample) allows quantification of expression levels and identification of transcript variants .

  • In situ hybridization: For spatial localization of OR6B3 mRNA within tissue sections.

Protein detection:

  • Immunohistochemistry/Immunofluorescence: Using validated anti-OR6B3 antibodies with appropriate controls.

  • Western blotting: For semi-quantitative analysis of protein expression.

  • Mass spectrometry: For unbiased protein identification, particularly valuable when antibody specificity is challenging.

For all methods, include appropriate positive controls (tissues known to express OR6B3) and negative controls. The expression pattern should be verified across multiple independent samples to account for individual variability. This multi-modal approach has successfully characterized the expression patterns of other olfactory receptors in retinal tissue .

What expression systems yield functional recombinant OR6B3 protein?

Alternative expression systems to consider for functional studies include:

  • Insect cell systems (Sf9 or High Five cells): Often preferred for GPCRs due to more native membrane composition.

  • Mammalian cell systems (HEK293 or CHO cells): For studies requiring mammalian post-translational modifications.

The choice of expression system should be guided by downstream applications—bacterial systems typically yield higher protein amounts for structural studies, while mammalian systems may be preferable for functional characterization requiring proper folding and post-translational modifications.

What are the optimal storage and handling conditions for recombinant OR6B3?

Based on empirical data for recombinant OR6B3, optimal storage and handling conditions include:

  • Long-term storage: Store at -20°C/-80°C, with -80°C preferred for extended stability .

  • Working aliquots: Can be stored at 4°C for up to one week .

  • Avoid repeated freeze-thaw cycles as they can compromise protein integrity .

  • Buffer composition: Store in Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 .

  • Reconstitution protocol: Use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL .

  • Stabilizing agents: Adding glycerol to a final concentration of 5-50% (optimally 50%) is recommended for long-term storage .

Creating multiple small aliquots upon initial reconstitution prevents the need for repeated freeze-thaw cycles and maintains protein quality for experimental reproducibility. When working with the protein for functional assays, consider detergent screening to identify conditions that maintain the native conformation of this membrane protein.

How can researchers investigate the putative function of OR6B3 in neuronal tissues?

Investigating OR6B3 function in neuronal tissues requires a multifaceted approach:

  • Signaling pathway analysis: As a GPCR, OR6B3 likely activates specific G proteins and downstream signaling cascades. Determine which G protein subtypes couple with OR6B3 in neuronal contexts using BRET/FRET assays, calcium imaging, or cAMP measurements in cells expressing recombinant OR6B3.

  • Ligand identification: Perform unbiased screening of potential ligands found in neuronal tissues, particularly retina, TG, and DRG. This can be accomplished using heterologous expression systems coupled with functional readouts like calcium flux or reporter gene activation.

  • Subcellular localization studies: Determine precise localization within neuronal cells through co-localization with organelle markers. Other ectopically expressed ORs show specific patterns—OR2W3 localizes to cone outer segments while OR5P3 is found in ciliary regions of photoreceptors .

  • Loss-of-function studies: Knockdown OR6B3 using siRNA or CRISPR-Cas9 in relevant neuronal models to observe phenotypic changes. Given that other neuronal ORs have been proposed to function in axon guidance and target recognition or in detecting alterations in cerebrospinal fluid composition , these processes should be specifically examined.

This systematic approach can help elucidate whether OR6B3 serves similar functions to other neuronally-expressed ORs or has unique roles in specific neuronal populations.

How does the high expression of OR6B3 in the retina relate to visual physiology?

The high expression of OR6B3 in retinal tissue (TPM 43-57) compared to other olfactory receptors raises intriguing questions about its potential role in visual physiology . To investigate this relationship:

  • Cell-type specific localization: Determine which retinal cell types express OR6B3 using co-immunostaining with cell-type markers. The localization patterns of other olfactory receptors provide clues—OR2W3 localizes to cone outer segments, suggesting potential involvement in phototransduction .

  • Temporal expression analysis: Analyze OR6B3 expression during retinal development to identify potential developmental roles versus ongoing functions in mature retina.

  • Electrophysiological studies: Record from retinal neurons before and after OR6B3 activation or inhibition to assess effects on visual signaling. This can be done in retinal explants or isolated retinal cells.

  • Visual function assessment: In animal models with OR6B3 manipulation, perform visual function tests to determine effects on specific aspects of vision (contrast sensitivity, color perception, dark adaptation).

  • Comparison with retinal diseases: Analyze OR6B3 expression in retinal disease models or human pathological specimens to identify potential associations with specific visual disorders.

This research direction is particularly compelling given the observed dysregulation of another neuronally-expressed olfactory receptor, OR2L13, in Parkinson's disease , suggesting potential disease associations for ectopically expressed ORs.

What mechanisms might explain the tissue-specific expression of OR6B3?

Understanding the tissue-specific expression of OR6B3 in neuronal tissues requires investigation of regulatory mechanisms:

  • Promoter analysis: Characterize the promoter and enhancer regions of OR6B3, looking for neuronal-specific regulatory elements. The deep sequencing studies of retinal tissue have already identified 5'UTR variants of OR6B3 that could be involved in tissue-specific expression regulation .

  • Transcription factor profiling: Identify transcription factors that bind to the OR6B3 promoter in neuronal tissues versus olfactory epithelium using ChIP-seq or promoter-reporter assays.

  • Epigenetic regulation: Analyze DNA methylation patterns and histone modifications at the OR6B3 locus across different tissues to identify epigenetic signatures associated with expression or silencing.

  • Alternative splicing analysis: Characterize tissue-specific splice variants of OR6B3 that may affect protein function or localization. The presence of alternative 5'UTRs has been confirmed in OR6B3 transcripts .

  • Comparative genomics: Analyze the conservation of regulatory regions across species, particularly in those showing similar ectopic expression patterns of OR6B3.

Understanding these mechanisms could provide insights into the evolutionary repurposing of olfactory receptors for non-olfactory functions and potentially reveal shared regulatory pathways among neuronally-expressed ORs.

What statistical approaches are most appropriate for analyzing OR6B3 expression data?

Analyzing OR6B3 expression data requires robust statistical methods to account for its homology with other ORs and potential variability across tissues and individuals:

  • Normalization methods: For RNA-Seq data, both FPKM (mFPKM ~18 for OR6B3 in retina) and TPM (43-57) values have been reported . TPM is generally preferred for cross-sample comparisons due to better normalization properties.

  • Differential expression analysis: When comparing OR6B3 expression across tissues or conditions, employ methods that account for biological variability such as DESeq2 or edgeR, with appropriate FDR correction for multiple testing.

  • Statistical thresholds for detection: Establish clear thresholds for considering OR6B3 as "expressed" in a tissue, ideally based on positive controls like retina where expression is confirmed.

  • Homology correction: For highly homologous genes like OR6B3 and OR6B2 (95% sequence identity), analyze unique mapping reads at distinguishing positions and apply appropriate statistical models for handling multi-mapping reads .

  • Data visualization: Implement genome browsers like IGV to visually inspect read alignments, particularly at regions distinguishing OR6B3 from homologs .

This comprehensive statistical approach enabled researchers to confidently determine that OR6B3, not OR6B2, is expressed in human retina despite their high sequence similarity .

How can researchers address contradictory findings regarding OR6B3 expression or function?

Contradictory findings regarding OR6B3 are not uncommon given technical challenges in studying olfactory receptors. To address discrepancies:

  • Method comparison analysis: Systematically compare results obtained through different methodologies (RNA-Seq, RT-PCR, immunohistochemistry) to identify technique-specific biases or limitations.

  • Sample variability assessment: Analyze potential sources of biological variability including age, sex, tissue preservation methods, and genetic background that might explain contradictory findings.

  • Antibody validation: For protein-level discrepancies, implement rigorous antibody validation including western blots with recombinant protein controls, peptide competition assays, and testing in tissues known to be negative for OR6B3.

  • Cross-laboratory validation: Establish standardized protocols and perform cross-laboratory validation studies to identify potential laboratory-specific effects.

  • Meta-analysis approaches: When multiple datasets exist, perform formal meta-analyses with appropriate statistical methods for heterogeneity assessment.

  • Genomic context examination: For expression discrepancies, examine the genomic context of OR6B3 to identify potential overlapping transcripts or readthrough transcription that might confound expression analysis .

How does OR6B3 compare to other ectopically expressed ORs in the retina?

A comparative analysis of OR6B3 with other ectopically expressed olfactory receptors in the retina reveals distinctive patterns:

Olfactory ReceptorExpression Level in RetinaAdditional Expression SitesSubcellular LocalizationPotential Function
OR6B3Highest (TPM 43-57)TG, DRGNot yet determinedNeuron-specific, potentially involved in detection of chemical composition or developmental processes
OR2W3Lower than OR6B3Limited dataCone outer segmentsPotentially involved in photoreceptor function
OR5P3Lower than OR6B3Exclusive to retinaCiliary region and inner segments of photoreceptorsPossible role in ciliary function
OR13J1Lower than OR6B3Neuronal tissuesNot yet determinedNeuron-specific, unknown function
OR2L13Lower than OR6B3BrainNot yet determinedNeuron-specific, dysregulated in Parkinson's disease

OR6B3 stands out as having the highest expression level among all ectopically expressed ORs in the retina . While some ORs like OR5P3 appear to be exclusively expressed in the retina, OR6B3 shows a broader neuronal expression pattern, being detected in the retina, TG, and DRG . This suggests potentially different functional roles compared to more restricted ORs.

The subcellular localization of OR6B3 in retinal cells has not yet been determined, unlike OR2W3 (localized to cone outer segments) and OR5P3 (found in the ciliary region) . Determining this localization would provide important clues about its function in visual processing or retinal development.

What experimental approaches from studies of other ectopically expressed ORs could be applied to OR6B3?

Several successful approaches used for studying other ectopically expressed ORs provide valuable methodological frameworks for OR6B3 research:

  • Subcellular localization mapping: The successful localization of OR2W3 to cone outer segments and OR5P3 to ciliary regions using immunofluorescence with specific markers provides a template for OR6B3 localization studies . Similar co-staining approaches with cellular compartment markers could reveal OR6B3's precise location in retinal cells.

  • Cell-type identification: Counter-staining with cell-type specific markers like FITC-labeled peanut agglutinin (which identified OR2W3 in cone photoreceptors) should be applied to determine which retinal cell types express OR6B3 .

  • High-resolution imaging techniques: The punctate staining pattern observed for OR5P3 across retinal layers demonstrates the importance of high-resolution imaging to detect potentially sparse or specific distribution patterns .

  • Functional coupling assays: Beyond localization, functional studies that identified signaling partners for other ectopically expressed ORs could be adapted for OR6B3.

  • Disease association studies: The finding that OR2L13 is dysregulated in Parkinson's disease suggests the value of investigating OR6B3 expression in various neurological and retinal disorders.

These complementary approaches would provide comprehensive insights into OR6B3's localization, cell-type distribution, and potential functional roles in the retina and other neuronal tissues.

What single-cell approaches could advance understanding of OR6B3 expression and function?

Single-cell technologies offer powerful tools to resolve cell-type specific expression and function of OR6B3:

  • Single-cell RNA sequencing (scRNA-seq): Apply scRNA-seq to retinal, TG, and DRG tissues to determine which specific cell types express OR6B3. This approach would resolve whether expression is uniform across a tissue or restricted to specific neuronal subtypes, providing crucial context for functional studies.

  • Single-cell ATAC-seq: Analyze chromatin accessibility in individual cells to identify cell-type specific regulatory elements controlling OR6B3 expression in neuronal tissues versus olfactory epithelium.

  • Spatial transcriptomics: Methods like Visium or MERFISH could map OR6B3 expression within the tissue architecture, providing spatial context that may reveal functional implications based on expression patterns.

  • Single-cell proteomics: Emerging mass cytometry techniques could detect OR6B3 protein in individual cells alongside markers for cell state and signaling pathway activation.

  • Live-cell imaging: Using fluorescent reporter constructs driven by the OR6B3 promoter in appropriate cell models would enable dynamic analysis of expression regulation in response to various stimuli.

These single-cell approaches would address the limitations of bulk tissue analysis and potentially resolve contradictory findings about OR6B3 expression by revealing cell-type heterogeneity within tissues.

What are the potential translational applications of OR6B3 research?

OR6B3 research may have several translational implications that extend beyond basic science:

  • Biomarker development: The neuron-specific expression pattern of OR6B3 suggests potential utility as a biomarker for specific neuronal populations or states in health and disease.

  • Drug discovery: If OR6B3 plays functional roles in retinal physiology, it could represent a novel therapeutic target for certain visual disorders. The precedent of OR2L13 dysregulation in Parkinson's disease suggests potential roles for ectopically expressed ORs in neurological conditions.

  • Diagnostic tools: Expression changes in OR6B3 might serve as early indicators of retinal pathology or neurodegeneration, similar to other neuronally-expressed ORs.

  • Regenerative medicine: Understanding the developmental role of OR6B3 in neuronal tissues could inform approaches to promote neuronal regeneration or differentiation in therapeutic contexts.

  • Biosensor development: The ligand-binding properties of OR6B3 could potentially be harnessed to develop biosensors for detecting specific molecules in biological or environmental samples.

Research exploring these translational aspects should proceed alongside fundamental studies of OR6B3 biology to maximize the clinical impact of discoveries about this fascinating ectopically expressed olfactory receptor.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.