Recombinant Human Olfactory receptor 6C4 (OR6C4)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Overview

OR6C4 belongs to the class A G-protein-coupled receptor (GPCR) family and is part of the largest gene family in the human genome, with ~400 functional olfactory receptors . Key characteristics include:

PropertyDetails
Gene SymbolOR6C4
AliasesOR12-10
UniProt IDQ8NGE1
Chromosomal Location12p13.2
Protein Structure7-transmembrane domain GPCR with extracellular ligand-binding regions

Ligand Binding and Signaling

  • OR6C4 operates via GPCR signaling: odorant binding activates Gα<sub>olf</sub>, triggering cAMP production and calcium influx .

  • Ligand specificity remains uncharacterized for OR6C4, but olfactory receptors generally exhibit broad tuning, responding to multiple structurally related odorants .

Non-Olfactory Roles

  • Sperm Function: OR6C4 transcripts are detected in human spermatozoa, suggesting roles in chemotaxis or fertilization . Antibody staining localizes related ORs (e.g., OR3A2, OR51E2) to sperm midpieces and flagella .

Key Tools and Assays

ApplicationDetails
ELISA DetectionQuantitative analysis of native OR6C4 in biological fluids
Calcium ImagingUsed in heterologous cells to study OR activation (e.g., HEK293S)
ImmunocytochemistryLocalizes OR proteins in sperm and olfactory neurons

Challenges in Recombinant Studies

  • Structural Complexity: GPCR stability and proper folding in recombinant systems require chaperones (e.g., RTP1/2) .

  • Ligand Screening: Deorphanizing OR6C4 demands high-throughput assays due to combinatorial odorant coding .

Future Directions

  • Structural Studies: Cryo-EM or crystallography could resolve OR6C4’s ligand-binding pocket, building on advances like OR51E2’s solved structure .

  • Functional Screens: Ligand libraries (e.g., M2OR database) may identify agonists/antistors .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
OR6C4; Olfactory receptor 6C4; Olfactory receptor OR12-10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR6C4
Target Protein Sequence
MKNRTMFGEFILLGLTNQPELQVMIFIFLFLTYMLSILGNLTIITLTLLDPHLQTPMYFF LRNFSFLEISFTSIFIPRFLTSMTTGNKVISFAGCLTQYFFAIFLGATEFYLLASMSYDR YVAICKPLHYLTIMSSRVCIQLVFCSWLGGFLAILPPIILMTQVDFCVSNILNHYYCDYG PLVELACSDTSLLELMVILLAVVTLMVTLVLVTLSYTYIIRTILRIPSAQQRTKAFSTCS SHMIVISLSYGSCMFMYINPSAKEGGAFNKGIAVLITSVTPLLNPFIYTLRNQQVKQAFK DSVKKIVKL
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 19632

KEGG: hsa:341418

STRING: 9606.ENSP00000377799

UniGene: Hs.495021

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for recombinant OR6C4 production?

Multiple expression systems have been validated for recombinant OR6C4 production, each with specific advantages depending on research requirements:

Expression SystemTag OptionsPurification MethodPurity LevelApplications
HEK-293 CellsHis tagAffinity chromatography>90% (Bis-Tris PAGE)Functional studies, structural analysis
Wheat GermGST tagGST-affinity chromatographyNot specifiedELISA, Western Blot, AP, AA
Cell-free Protein SynthesisStrep TagNot specified>70-80% (SDS-PAGE)ELISA, WB, SDS

Mammalian expression systems like HEK-293 cells provide proper folding and post-translational modifications critical for maintaining the native conformation of this transmembrane protein . While bacterial systems offer higher yields, they often fail to properly fold complex membrane proteins like olfactory receptors. The wheat germ system represents a compromise, offering moderate yields with better folding than bacterial systems .

For functional studies requiring native-like receptor behavior, the HEK-293 expression system with affinity purification is recommended as it preserves the structural integrity necessary for ligand binding and signaling studies .

How can researchers effectively solubilize and stabilize recombinant OR6C4 for structural studies?

Solubilization and stabilization of recombinant OR6C4 require specialized approaches due to its hydrophobic transmembrane domains. The methodological workflow should include:

  • Expression optimization: Use HEK-293 cells with inducible expression systems to prevent toxicity from membrane protein overexpression .

  • Membrane extraction: Apply a two-step solubilization process:

    • Initial membrane preparation using ultracentrifugation (100,000×g for 1 hour)

    • Solubilization with mild detergents such as n-Dodecyl β-D-maltoside (DDM) at 1-2% or CHAPSO at 0.5-1%

  • Stabilization techniques:

    • Addition of cholesterol hemisuccinate (CHS) at 0.1-0.2% to mimic native membrane environment

    • Use of specific ligands during purification to stabilize active conformations

    • Application of nanodiscs or lipid cubic phase technologies for structural studies

  • Buffer optimization: Maintain protein in buffers containing 20 mM HEPES pH 7.5, 150 mM NaCl, 0.05% DDM, 0.01% CHS, and 10% glycerol to prevent aggregation during storage .

For cryoEM or crystallography studies, consider incorporating fusion partners such as T4 lysozyme or BRIL between transmembrane helices to increase soluble protein surface area for crystal contacts.

What are the validated methods for confirming proper folding and functionality of recombinant OR6C4?

Confirming proper folding and functionality of recombinant OR6C4 requires multiple complementary approaches:

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to verify alpha-helical content consistent with 7-TM structure

    • Fluorescence-based thermal shift assays to assess protein stability (properly folded OR6C4 should exhibit cooperative unfolding)

    • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS) to confirm monomeric state and absence of aggregation

  • Ligand binding assays:

    • Microscale thermophoresis (MST) with fluorescently labeled OR6C4

    • Surface plasmon resonance (SPR) using immobilized receptor

    • Fluorescence-based ligand binding assays using environment-sensitive fluorophores

  • Functional characterization:

    • Calcium mobilization assays in transiently transfected cells expressing OR6C4 and Gα15/16

    • BRET-based G protein activation assays

    • cAMP accumulation measurements using FRET-based sensors

Proper experimental controls should include denatured protein samples and structurally related olfactory receptors to establish specificity of observed signals .

What strategies can be employed to identify specific ligands for OR6C4?

Identifying specific ligands for OR6C4 requires multi-faceted screening approaches:

  • High-throughput screening methodology:

    • Calcium imaging in OR6C4-expressing cells against odorant libraries

    • BRET/FRET-based conformational change assays

    • Automated patch-clamp electrophysiology for direct measurement of channel activation

  • Computational approaches:

    • Homology modeling based on related GPCR structures

    • Virtual screening of odorant databases against the binding pocket

    • Molecular dynamics simulations to predict ligand-receptor interactions

  • Structure-activity relationship studies:

    • Systematically test structurally related odorants to map chemical features required for activation

    • Create focused libraries based on preliminary hits

    • Develop pharmacophore models based on active compounds

  • In vivo validation:

    • Gene knockout studies in animal models to confirm behavioral responses

    • Electro-olfactogram (EOG) recordings with identified compounds

When implementing these methods, researchers should account for potential receptor promiscuity, as olfactory receptors often respond to multiple structurally diverse ligands with varying affinities .

How can researchers accurately measure binding kinetics for OR6C4-ligand interactions?

Measuring binding kinetics for OR6C4-ligand interactions requires specialized techniques adapted for membrane proteins:

  • Surface plasmon resonance (SPR) protocol:

    • Immobilize purified OR6C4 (>90% purity) in nanodiscs or supported lipid bilayers on sensor chips

    • Maintain temperature at 25°C and flow rate at 30 μL/min

    • Use concentration series (typically 0.1-100 μM) of potential ligands

    • Extract association (kon) and dissociation (koff) rate constants using Langmuir binding models

    • Calculate equilibrium dissociation constant (KD = koff/kon)

  • Isothermal titration calorimetry (ITC) adaptations:

    • Use high receptor concentrations (10-20 μM) to compensate for typically weak odorant binding

    • Account for detergent micelles in reference cell

    • Employ displacement ITC for very high-affinity ligands

  • Fluorescence-based methods:

    • Time-resolved fluorescence resonance energy transfer (TR-FRET) with labeled receptor and ligand

    • Kinetic analysis of calcium flux in real-time using fluorescent calcium indicators

  • Data analysis considerations:

    • Apply appropriate mathematical models accounting for potential allosteric effects

    • Consider receptor heterogeneity in expression systems

    • Validate with multiple independent methods

Typical affinity values for olfactory receptors range from nanomolar to micromolar KD values, with OR6C4 potentially exhibiting distinct binding profiles depending on the ligand chemical structure .

What is the genomic organization of the OR6C4 gene and how does it compare to other olfactory receptor genes?

The OR6C4 gene exhibits the characteristic genomic organization of olfactory receptor genes:

  • Genomic structure:

    • Single exon gene (no introns) encoding the full 309 amino acid protein

    • Located within an olfactory receptor gene cluster on chromosome 12

    • Approximately 1 kb coding sequence

  • Comparative genomics:

    • Belongs to family 6, subfamily C of olfactory receptors

    • Shares evolutionary conservation patterns with other Class II (tetrapod-specific) olfactory receptors

    • Contains conserved motifs found in the GPCR superfamily

  • Regulatory elements:

    • Promoter regions containing binding sites for transcription factors like Olf-1 and ATF-5

    • Potential enhancer elements controlling cell-type specific expression

    • Putative CpG islands suggesting epigenetic regulation

  • Phylogenetic analysis:

    • Evolutionary relationship to other olfactory receptor subfamilies

    • Species-specific variations that may correlate with ecological niches

    • Evidence for positive selection in binding regions

This genomic organization reflects the evolutionary history of OR6C4 within the largest gene family in the mammalian genome, with implications for functional diversification and specificity .

How is OR6C4 expression regulated in different tissues and developmental stages?

OR6C4 expression exhibits tissue-specific and developmental regulation patterns:

  • Spatial expression pattern:

    • Primarily expressed in olfactory epithelium

    • Following the "one neuron-one receptor" rule of olfactory sensory neurons

    • Possible ectopic expression in non-olfactory tissues requiring validation

  • Developmental regulation:

    • Expression initiates during mid-embryonic development

    • Reaches stable levels in mature olfactory epithelium

    • May undergo activity-dependent regulation throughout life

  • Regulatory mechanisms:

    • Epigenetic control through histone modifications

    • DNA methylation patterns correlating with expression levels

    • Transcription factor networks including LHX2, OLF1, and CREB family proteins

  • Expression analysis methods:

    • Single-cell RNA sequencing to map expression in individual olfactory sensory neurons

    • In situ hybridization for spatial localization in tissue sections

    • Quantitative PCR for temporal expression profiling

Recent studies have suggested potential associations between olfactory receptor expression patterns and neuropsychiatric conditions, with emerging evidence linking olfactory genes to conditions like major depression, particularly in specific demographic subgroups .

What cellular assays are most reliable for measuring OR6C4 activation and signaling?

Reliable cellular assays for measuring OR6C4 activation require careful experimental design:

  • Calcium mobilization assays:

    • Transiently co-transfect HEK293 cells with OR6C4 and Gα15/16 (promiscuous G protein)

    • Load cells with calcium-sensitive dyes (Fluo-4 AM)

    • Measure fluorescence changes upon odorant application

    • Normalize to ionomycin response (100% calcium release)

  • cAMP measurement systems:

    • Stable cell lines expressing OR6C4 and appropriate G proteins

    • BRET/FRET-based sensors for real-time cAMP monitoring

    • Endpoint assays using enzyme immunoassays or GloSensor technology

    • Include forskolin controls for assay validation

  • BRET-based G protein activation assays:

    • Direct measurement of G protein coupling to receptor

    • Real-time kinetic analysis of activation and deactivation

    • Determination of G protein subtype preference

  • Electrophysiological recordings:

    • Patch-clamp analysis in heterologous expression systems

    • Measurement of current changes upon odorant application

    • Characterization of channel coupling downstream of receptor activation

Each assay type provides complementary information about receptor functionality, with calcium assays offering high throughput but indirect measurement, while BRET provides direct molecular interaction data with lower throughput .

How can OR6C4 be utilized in biosensor applications for environmental monitoring?

OR6C4 offers unique properties for developing biosensor applications:

  • Biosensor platform designs:

    • Microelectrode array sensors with immobilized OR6C4-expressing cells

    • Field-effect transistors (FETs) with immobilized purified receptors

    • Surface acoustic wave (SAW) devices functionalized with OR6C4

    • Optical waveguide-based sensors using fluorescent reporting systems

  • Immobilization strategies:

    • Encapsulation of OR6C4-expressing cells in hydrogels

    • Oriented immobilization of purified receptor (>90% purity) via His-tag or other affinity tags

    • Nanodisc technology to maintain receptor in native-like membrane environment

    • Self-assembled monolayers with controlled receptor orientation

  • Signal transduction mechanisms:

    • Coupling to fluorescent reporters via conformational change detection

    • Impedance measurements reflecting receptor-ligand binding

    • Integration with artificial neural networks for pattern recognition

    • Bioluminescence resonance energy transfer (BRET) systems

  • Practical challenges and solutions:

    • Receptor stability enhancement through mutagenesis

    • Incorporation of antioxidants to prevent oxidative damage

    • Humidity control systems to maintain functionality

    • Reference sensors for drift compensation

These biosensor applications demonstrate the potential translation of basic OR6C4 research into environmental monitoring tools, particularly for detecting specific volatile organic compounds of interest .

What are the current challenges in determining the three-dimensional structure of OR6C4?

Determining the three-dimensional structure of OR6C4 faces several significant challenges:

  • Expression and purification barriers:

    • Low expression levels in heterologous systems

    • Tendency to aggregate during extraction from membranes

    • Requirement for detergent optimization to maintain native fold

    • Need for milligram quantities of homogeneous protein for crystallography

  • Crystallization challenges:

    • Limited polar surface area for crystal contact formation

    • Conformational heterogeneity in ligand-free state

    • Detergent micelle interference with crystal packing

    • Thermal instability leading to denaturation during crystallization trials

  • Current methodological approaches:

    • Fusion protein strategies (T4 lysozyme, BRIL) to increase crystallizable surface area

    • Nanobody or antibody co-crystallization to stabilize specific conformations

    • Lipidic cubic phase crystallization to mimic membrane environment

    • Single-particle cryo-electron microscopy for detergent-solubilized samples

  • Computational alternatives:

    • Homology modeling based on related GPCR structures

    • Molecular dynamics simulations to refine models

    • Deep learning approaches like AlphaFold for structure prediction

    • Integration of experimental constraints from biochemical studies

Despite these challenges, recent advances in structural biology techniques, particularly in cryo-EM and computational approaches, offer promising avenues for determining OR6C4 structure at atomic resolution .

How can hydrogen-deuterium exchange mass spectrometry (HDX-MS) inform OR6C4 conformational dynamics?

Hydrogen-deuterium exchange mass spectrometry (HDX-MS) offers valuable insights into OR6C4 conformational dynamics:

  • Experimental design for OR6C4 HDX-MS:

    • Purify OR6C4 to >90% homogeneity in stable detergent micelles

    • Establish deuterium labeling conditions (typically pD 7.0, 25°C)

    • Compare exchange rates between apo and ligand-bound states

    • Focus analysis on regions critical for activation (transmembrane domains)

  • Data interpretation framework:

    • Map deuterium uptake onto homology models or experimental structures

    • Identify regions with differential exchange rates upon ligand binding

    • Correlate exchange protection with predicted binding sites

    • Compare dynamics across multiple ligands with different efficacies

  • Technical adaptations for membrane proteins:

    • Optimize detergent concentration to minimize back-exchange during analysis

    • Employ rapid quenching and proteolysis at low pH (2.5) and temperature (0°C)

    • Use short deuterium exposure times (10s-1000s) to capture fast-exchanging regions

    • Consider nanodiscs for more native-like environment

  • Integration with other methods:

    • Combine with site-directed mutagenesis to validate dynamic regions

    • Correlate with molecular dynamics simulations

    • Integrate with functional data from cellular assays

    • Validate findings with other biophysical techniques (NMR, EPR)

HDX-MS can reveal ligand-induced conformational changes in OR6C4, providing insights into activation mechanisms and allosteric modulation that are difficult to obtain through other techniques .

What evidence exists for OR6C4 polymorphisms associated with olfactory dysfunction or other conditions?

Emerging evidence suggests potential associations between OR6C4 genetic variations and clinical phenotypes:

Recent research has identified potential connections between olfactory genes and major depression, particularly in highly educated women with low neuroticism and low body fat percentage, suggesting complex interactions between genetic factors and demographic variables .

How can OR6C4 research contribute to drug discovery for olfactory disorders?

OR6C4 research offers multiple avenues for therapeutic development:

  • Target validation strategies:

    • Gene knockout studies in animal models

    • CRISPR-based approaches for precise genetic manipulation

    • Patient-derived cellular models expressing variant receptors

  • Screening platforms for therapeutic discovery:

    • High-throughput assays for receptor modulators

    • Structure-based virtual screening using computational models

    • Fragment-based drug discovery targeting binding pockets

  • Therapeutic approaches:

    • Small molecule agonists or antagonists for selective modulation

    • Allosteric modulators to enhance or inhibit function

    • Gene therapy approaches for loss-of-function variants

    • Nanobody-based therapeutics for specific targeting

  • Translational considerations:

    • Blood-brain barrier penetration for CNS delivery

    • Nasal delivery systems for local targeting

    • Pharmacokinetic optimization for sustainable receptor engagement

    • Biomarker development for patient stratification

Future therapeutic applications may extend beyond olfactory disorders, as emerging evidence suggests potential roles for olfactory receptors in unexpected conditions, including mood disorders in specific demographic subgroups .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.