Recombinant Human Olfactory receptor 6F1 (OR6F1)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant OR6F1 is synthesized using heterologous expression systems, primarily E. coli or baculovirus-infected insect cells .

Expression Systems and Tags

SystemTagApplicationSource
E. coliN-terminal His-tagHigh-yield production, purificationCusabio , THE BioTek
BaculovirusUndisclosedPartial protein for structural studiesCusabio

Protein purification involves immunoaffinity chromatography (e.g., His-tag binding) and gel filtration, yielding >85% purity .

Research Applications

Recombinant OR6F1 is used to study:

  • Ligand Binding: In vitro assays (e.g., fluorescence-based) to identify odorant ligands .

  • Structural Analysis: Circular dichroism (CD) and X-ray crystallography to probe folding and dimerization .

  • Functional Assays: cAMP or luciferase-based assays in HEK293 cells to assess signaling activity .

Key Findings

  • Dimerization: Purified OR6F1 exists as monomers and dimers, as shown by size-exclusion chromatography (SEC-MALS) .

  • Olfactory Variability: Copy-number variation (CNV) in OR genes, including OR6F1, may influence olfactory perception diversity .

Detection and Validation

A polyclonal rabbit antibody (e.g., Boster Bio A16903) is used to detect OR6F1 via Western blot (WB) and ELISA .

Antibody DetailsSpecification
ImmunogenPeptide (AA 220–300)
ApplicationsWB (1:500–2000), ELISA (1:5000–20000)
ReactivityHuman OR6F1

Genetic and Functional Variability

OR6F1 is part of a gene family prone to segmental duplication and CNVs, which may explain interindividual differences in olfactory acuity . While CNVs in OR6F1 have been reported, functional studies remain limited .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
OR6F1; Olfactory receptor 6F1; Olfactory receptor OR1-38
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR6F1
Target Protein Sequence
MDTGNKTLPQDFLLLGFPGSQTLQLSLFMLFLVMYILTVSGNVAILMLVSTSHQLHTPMY FFLSNLSFLEIWYTTAAVPKALAILLGRSQTISFTSCLLQMYFVFSLGCTEYFLLAAMAY DRCLAICYPLHYGAIMSSLLSAQLALGSWVCGFVAIAVPTALISGLSFCGPRAINHFFCD IAPWIALACTNTQAVELVAFVIAVVVILSSCLITFVSYVYIISTILRIPSASGRSKAFST CSSHLTVVLIWYGSTVFLHVRTSIKDALDLIKAVHVLNTVVTPVLNPFIYTLRNKEVRET LLKKWKGK
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15027

KEGG: hsa:343169

STRING: 9606.ENSP00000305640

UniGene: Hs.591529

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfactory Receptor 6F1 (OR6F1) and what is its primary function?

Olfactory receptor 6F1 (OR6F1) belongs to the olfactory receptor family, which are primarily responsible for detecting odorant molecules and initiating signal transduction pathways that ultimately lead to smell perception. These receptors interact with odorant molecules in the nose to trigger neuronal responses that enable smell perception . OR6F1 is a member of the large G-protein-coupled receptor (GPCR) family, characterized by a seven-transmembrane domain structure similar to many neurotransmitter and hormone receptors .

The gene encoding OR6F1 consists of a single coding exon, which is a common feature among olfactory receptor genes. The protein functions by recognizing specific odorant molecules and mediating G protein-coupled signal transduction, converting chemical signals from odorants into electrical signals that can be processed by the brain . As with other olfactory receptors, OR6F1 likely exhibits selectivity for certain odorant structures, though specific ligands for this receptor have not been thoroughly characterized in the literature, making it what researchers often refer to as an "orphan receptor" .

What is the structural composition of human OR6F1?

Human OR6F1 consists of 308 amino acids and exhibits the characteristic seven-transmembrane domain architecture common to G-protein coupled receptors . The full amino acid sequence is available in research databases and commercial product descriptions, enabling structural analysis and recombinant expression . The protein's molecular weight is approximately 60.4 kDa when expressed as a recombinant protein with a GST-tag at the N-terminal .

The structural composition includes several functional domains critical for odorant binding and signal transduction. The transmembrane regions form a pocket where odorant molecules can bind, while intracellular loops interact with G proteins to propagate the signal. The protein belongs specifically to the G-protein coupled receptor 1 family, sharing structural homology with other members of this extensive receptor family . Understanding this structure is crucial for researchers investigating ligand-binding properties, signal transduction mechanisms, or developing targeted interventions for olfactory disorders.

How is recombinant OR6F1 typically produced for research applications?

Recombinant OR6F1 for research applications is typically produced using cell-free expression systems or bacterial expression systems with appropriate tags to facilitate purification and detection . Commercial preparations often include tags such as GST (glutathione S-transferase) at the N-terminal, which aids in protein purification and can potentially enhance solubility . The recombinant proteins are generally supplied in a buffer system optimized for stability, such as 50mM Tris-HCl with 10mM reduced glutathione at pH 8.0 .

The methodological approach typically involves cloning the OR6F1 coding sequence into an expression vector, expressing the protein in the chosen system, and purifying it using affinity chromatography based on the incorporated tag. For GST-tagged proteins, glutathione-based purification is commonly employed. The purified protein typically undergoes quality control testing to ensure integrity and purity, with commercial preparations often guaranteeing ≥85% purity suitable for SDS-PAGE analysis . Researchers should be aware that the presence of tags may influence protein folding and function in some applications, potentially necessitating tag removal for certain experiments.

What experimental applications are suitable for recombinant OR6F1 protein?

Recombinant OR6F1 protein is suitable for multiple experimental applications in molecular and cellular biology research. According to commercial product specifications, typical applications include antibody production, protein array development, ELISA (Enzyme-Linked Immunosorbent Assay), and Western blot analysis . In antibody production, the recombinant protein serves as an immunogen to generate specific antibodies against OR6F1, which can subsequently be used for protein detection and localization studies.

For protein array applications, immobilized OR6F1 can be used to screen for binding partners or potential ligands. In ELISA setups, the protein enables quantitative detection of anti-OR6F1 antibodies or competitive binding assays for ligand screening. Western blotting applications typically involve using the recombinant protein as a positive control or for antibody validation. Beyond these standard applications, researchers may also employ recombinant OR6F1 in structural studies, ligand-binding assays, and functional reconstitution experiments to investigate the receptor's signaling properties in controlled environments. When designing experiments, it is important to consider the presence of any tags (such as GST) and their potential impact on protein behavior and interactions.

How can researchers effectively distinguish between OR6F1 and other closely related olfactory receptors in experimental settings?

Distinguishing OR6F1 from closely related olfactory receptors presents a significant challenge due to sequence homology within this large gene family. A multi-modal approach combining genetic, immunological, and functional techniques offers the most reliable discrimination strategy. At the genetic level, designing highly specific PCR primers targeting unique regions of the OR6F1 gene sequence enables selective amplification. Quantitative RT-PCR with carefully validated primers can distinguish OR6F1 expression from other family members.

Immunologically, researchers should develop and validate antibodies against unique epitopes of OR6F1, ideally targeting the N-terminal region or one of the extracellular loops where sequence divergence is greatest among olfactory receptors. Epitope mapping and cross-reactivity testing against closely related receptors are essential quality control steps. Commercial antibodies should be thoroughly validated through knockout/knockdown controls before experimental use.

Functionally, heterologous expression systems combined with response profiling can exploit differences in ligand selectivity between OR6F1 and related receptors. By expressing OR6F1 in cell lines and characterizing activation patterns across multiple ligands, a "fingerprint" response profile can be established. CRISPR-Cas9 gene editing to create OR6F1-specific knockout models provides definitive controls for validating specificity in all these approaches. The detection of functional associations across biological entities spanning different categories (molecular profiles, functional terms, chemicals, etc.) can further help validate OR6F1-specific effects .

What are the current challenges in expressing functional OR6F1 in heterologous systems for structural and functional studies?

Expression of functional olfactory receptors including OR6F1 in heterologous systems presents multiple technical challenges that have limited structural and functional characterization. The primary obstacle is poor plasma membrane trafficking in conventional expression systems. Olfactory receptors often misfold and accumulate in the endoplasmic reticulum when expressed outside their native cellular environment. Several methodological approaches can address these challenges.

Expression enhancement strategies include using specialized expression vectors incorporating N-terminal fusion tags like Rhodopsin or 5HT3A receptor sequences that have been shown to improve membrane trafficking. Co-expression with receptor transporting proteins (RTPs) and receptor expression enhancing proteins (REEPs) can significantly improve surface expression. For structural studies, thermostabilizing mutations identified through alanine-scanning mutagenesis can enhance receptor stability without compromising function.

Current cell-free expression systems offer advantages for producing OR6F1 for structural studies, as evidenced by commercial availability of such preparations . These systems bypass cellular trafficking machinery and can directly incorporate the receptor into nanodiscs or liposomes. For functional characterization, researchers should consider using specialized cell lines like Hana3A (derived from HEK293 cells but engineered to express accessory factors) or olfactory neuron-derived cell lines that provide a more native-like environment.

The detection sensitivity presents another challenge, as OR6F1 activation may produce subtle signals. Employing amplification strategies like chimeric G proteins (e.g., Gα15/16) that couple to calcium signaling regardless of the receptor's native G protein preference can enhance detection. Luciferase-based reporter systems also offer improved sensitivity for detecting activation. Despite these advances, researchers should interpret results cautiously, as modifications to enhance expression may alter native receptor properties.

How can computational approaches enhance our understanding of OR6F1 function and ligand interactions?

Computational approaches provide powerful tools for investigating OR6F1 function and ligand interactions despite limited experimental data. Homology modeling based on structurally characterized GPCRs offers insights into the three-dimensional structure of OR6F1. These models can be refined through molecular dynamics simulations to explore conformational states relevant to receptor activation and identify key residues involved in ligand binding. Virtual screening campaigns using these structural models can predict potential ligands from large compound libraries, narrowing down candidates for experimental validation.

Deep learning frameworks represent a cutting-edge approach for predicting receptor-ligand interactions. Recent research demonstrates that transformer-based models with pre-training, particularly the ALBERT pre-trained model, significantly outperform traditional approaches for predicting GPCR-drug interactions . These models achieve ROC-AUC values of 0.725 and PR-AUC of 0.589, maintaining robust performance even when tested on proteins distinct from those in training sets . This capability is particularly valuable for orphan receptors like OR6F1 where experimental data is limited.

For functional prediction, co-expression network analysis can identify genes that share expression patterns with OR6F1 across tissues and experimental conditions, suggesting potential functional associations. The Harmonizome database indicates OR6F1 has 936 functional associations spanning 8 biological categories extracted from 41 datasets . These associations include co-expressed genes, tissue expression patterns, and disease relationships that can guide hypothesis formation. Protein-protein interaction predictions can also identify potential signaling partners beyond canonical G proteins. Integration of these computational approaches with targeted experimental validation represents the most efficient strategy for advancing our understanding of OR6F1 biology.

What evidence exists for OR6F1 involvement in physiological processes beyond olfaction or in pathological conditions?

While OR6F1 is primarily characterized as an olfactory receptor, emerging evidence suggests potential roles beyond canonical olfaction. Analyzing the functional associations of OR6F1 reveals connections to diverse biological processes and disease states, though these associations require further experimental validation. Database analysis shows OR6F1 has 936 functional associations across multiple biological categories, including molecular profiles, organism-level functions, disease associations, and tissue-specific expression patterns .

Disease association databases indicate potential links between OR6F1 and certain pathological conditions. The DISEASES Text-mining Gene-Disease Association Evidence Scores database reports co-occurrence of OR6F1 with specific diseases in biomedical literature abstracts . Similarly, the DisGeNET Gene-Disease Associations database identifies associations between OR6F1 and diseases in GWAS and other genetic association datasets . These computational predictions provide starting points for investigating OR6F1's role in disease processes.

Tissue expression profiling reveals OR6F1 expression beyond the olfactory epithelium. Datasets including the Allen Brain Atlas, BioGPS Human Cell Type and Tissue Gene Expression Profiles, and TISSUES Experimental Tissue Protein Expression Evidence Scores identify tissues with differential OR6F1 expression . This ectopic expression pattern supports the emerging concept of olfactory receptors serving functions beyond smell perception.

Interestingly, recent deep learning approaches have predicted potential interactions between orphan GPCRs like OR6F1 and approved drugs, suggesting possible pharmacological targeting in therapeutic contexts . Although preliminary, these findings highlight the potential broader significance of OR6F1 in human physiology and pathology. Researchers investigating these non-canonical roles should employ tissue-specific knockout models and conditional expression systems to elucidate the physiological relevance of OR6F1 beyond the olfactory system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.