Recombinant Human Olfactory receptor 6K3 (OR6K3)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of OR6K3

OR6K3 (UniProt ID: Q8NGY3) belongs to the class II tetrapod-specific olfactory receptors . Key features include:

PropertyDescription
Gene FamilyOlfactory receptor family 6, subfamily K
Protein Structure331 amino acids with 7 transmembrane domains
Molecular Weight~37 kDa (predicted)
Conserved MotifsClass A GPCR motifs, including metal ion-binding sites for ligand interaction
Expression SitesOlfactory epithelium, airway epithelium, and ectopic sites (e.g., sperm cells)

Olfactory Mechanism Studies

OR6K3 is used to investigate:

  • Ligand specificity: Olfactory receptors recognize odorants through combinatorial coding .

  • Signal transduction: Activation triggers Gα<sub>olf</sub>-mediated cAMP pathways .

  • Metal ion dependency: Copper/zinc binding may modulate thiol odor detection .

Cancer Biomarker Exploration

While OR6K3 itself is not yet validated as a biomarker, related olfactory receptors (e.g., OR51E2 in prostate cancer) show diagnostic potential . OR6K3’s ectopic expression in non-olfactory tissues is under investigation for disease associations .

Challenges in OR6K3 Research

  1. Ligand Deorphanization: No confirmed natural or synthetic ligands are reported .

  2. Functional Expression: Poor membrane localization in heterologous systems (e.g., HEK293) limits activity assays .

  3. Antibody Specificity: Commercial antibodies show variable cross-reactivity .

Future Directions

  1. High-Throughput Screening to identify OR6K3 ligands .

  2. Cryo-EM Studies to resolve full 3D structures .

  3. Clinical Correlation with ectopic expression patterns in carcinomas .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand your specific requirements. Please indicate any format preferences during order placement, and we will fulfill your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR6K3; Olfactory receptor 6K3; Olfactory receptor OR1-18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-331
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR6K3
Target Protein Sequence
MCWTMPSPFTGSSTRNMESGNQSTVTEFIFTGFPQLQDGSLLYFFPLLFIYTFIIIDNLL IFSAVRLDTHLHNPMYNFISIFSFLEIWYTTATIPKMLSNLISEKKAISMTGCILQMYFF HSLENSEGILLTTMAIDRYVAICNPLRYQMIMTPRLCAQLSAGSCLFGFLILLPEIVMIS TLPFCGPNQIHQIFCDLVPVLSLACTDTSMILIEDVIHAVTIIITFLIIALSYVRIVTVI LRIPSSEGRQKAFSTCAGHLMVFPIFFGSVSLMYLRFSDTYPPVLDTAIALMFTVLAPFF NPIIYSLRNKDMNNAIKKLFCLQKVLNKPGG
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15030

KEGG: hsa:391114

STRING: 9606.ENSP00000357127

UniGene: Hs.554488

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Human Olfactory Receptor 6K3 (OR6K3)?

Recombinant Human Olfactory Receptor 6K3 (OR6K3) is a member of the G-protein coupled receptor (GPCR) family that functions in olfactory sensory neurons to detect odorant molecules and initiate the perception of smell. OR6K3 is also known by the alternative name Olfactory receptor OR1-18 and is identified by UniProt number Q8NGY3 . The full-length protein consists of 331 amino acids and, like other olfactory receptors, likely contains the characteristic seven-transmembrane domain structure typical of GPCRs . OR6K3 is part of the human olfactory receptor repertoire, which consists of approximately 400 intact receptors that collectively enable the discrimination of thousands of different odors through a combinatorial coding mechanism . Currently, OR6K3 is categorized among the least-studied targets in the proteome, with minimal published research and no known drug or small molecule activities documented in the Pharos database .

What expression systems are used for studying OR6K3 in laboratory settings?

Heterologous expression systems provide the primary platform for studying olfactory receptors like OR6K3 in controlled laboratory environments. The most widely used cell line for olfactory receptor studies is the Hana3A cell line, which is specialized for olfactory receptor expression as it contains accessory factors that enhance receptor trafficking to the cell membrane . When expressing OR6K3, researchers typically clone the open reading frame into expression vectors such as the pCI expression vector, often adding a Rho tag (the first 20 residues of human rhodopsin) to improve surface expression . Co-expression with receptor-transporting proteins like RTP1S is essential for functional expression, as these chaperones facilitate proper folding and trafficking of the receptor to the cell surface . Other expression systems documented in olfactory receptor research include HEK293T cells, yeast-based systems, Xenopus oocytes, and occasionally native olfactory sensory neurons, though the choice of system can significantly impact receptor functionality and response characteristics . Researchers should note that assay-dependent bias has been observed when comparing olfactory receptor responses across different expression systems, making it crucial to consider this variable when interpreting results .

What are the optimal storage conditions for recombinant OR6K3 protein?

For optimal preservation of recombinant OR6K3 protein activity, storage conditions must be carefully controlled. According to product specifications, recombinant OR6K3 should be stored at -20°C for standard use, while long-term storage is recommended at either -20°C or -80°C to minimize degradation . The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized to maintain protein stability and prevent denaturation during freeze-thaw cycles . To preserve functionality, working aliquots should be stored at 4°C for no longer than one week, as repeated freeze-thaw cycles can significantly compromise protein integrity and are explicitly not recommended for this receptor . When preparing experiments, it is advisable to create single-use aliquots sized appropriately for experimental needs to avoid repeated thawing of the stock solution. For experiments requiring dilution, researchers should determine whether the storage buffer components (particularly glycerol) might interfere with downstream applications and adjust protocols accordingly.

What functional assays are used to study OR6K3 activation?

Functional characterization of OR6K3 activation typically employs reporter-based assays that measure second messenger production following receptor stimulation. The most widely used method is the Dual-Glo Luciferase Assay System, where cells expressing the receptor are co-transfected with a CRE-luciferase reporter that produces luminescence in response to cAMP production following receptor activation . This system typically includes controls for transfection efficiency, such as co-transfection with Renilla luciferase (pRL-SV40), allowing for normalized measurements across experimental conditions . Additional functional assays documented for olfactory receptor research include calcium imaging, which measures intracellular calcium flux following receptor activation, and SEAP (secreted embryonic alkaline phosphatase) assays . For high-throughput screening approaches, researchers typically challenge receptor-expressing cells with odorants at multiple concentrations (commonly 1μM, 10μM, and 100μM) and measure responses relative to baseline and positive controls . When establishing a new assay for OR6K3, it is advisable to include well-characterized olfactory receptors with known ligands (such as Olfr544 with nonanedioic acid) as positive controls to validate the experimental system .

What is currently known about OR6K3 ligands and activation patterns?

Current knowledge about specific ligands that activate OR6K3 remains extremely limited, as indicated by its classification in databases as a target with minimal experimental characterization . Unlike some well-studied olfactory receptors that have undergone systematic deorphanization efforts, OR6K3 does not appear in the list of receptors with published ligands, which currently represents only about 10% of the human olfactory receptor repertoire . The lack of identified ligands for OR6K3 reflects a broader challenge in the field, where the vast chemical space of potential odorants (billions of molecules) compared to the number of receptors (hundreds) creates an enormous search problem that remains largely unsolved . Based on knowledge of olfactory coding principles, OR6K3 likely responds to multiple structurally related odorants following the combinatorial coding principle observed across the olfactory system, where each receptor responds to multiple odorants and each odorant activates multiple receptors . Researchers interested in identifying OR6K3 ligands would need to conduct systematic screening approaches similar to those described in the literature, testing candidate odorants at multiple concentrations and validating hits through dose-response analyses .

What screening methodologies are most effective for identifying OR6K3 ligands?

Developing an effective screening strategy for OR6K3 ligands requires a multi-tiered approach that balances throughput with confirmation of true positives. Based on successful deorphanization campaigns for other olfactory receptors, a recommended approach would begin with a primary screen in which OR6K3 is challenged with a diverse panel of odorants, typically at a concentration of 100μM, to identify initial hits . This primary screen should include appropriate controls, such as broadly-tuned olfactory receptors with known responses and standardization wells that allow for plate-to-plate normalization . Following identification of potential hits (typically the top 5% of responses), a secondary screen with multiple concentrations (1μM, 10μM, and 100μM) should be conducted in triplicate to eliminate false positives and begin assessing dose-dependency . Final validation requires full dose-response curves using concentrations ranging from 10nM to 10mM, with statistical analysis to confirm that the response parameters (EC50, maximum response) indicate true activation above vector-only controls . Throughout this process, careful attention to experimental variables is crucial, including consistent cell passage numbers, transfection efficiency, and odor delivery methods. The M2OR database provides valuable information on previously tested odorant-receptor pairs and can guide selection of initial test compounds based on structural similarities with known ligands for phylogenetically related receptors .

How can dose-response analyses be optimized for OR6K3 functional characterization?

Optimizing dose-response analyses for OR6K3 requires careful consideration of multiple experimental parameters to ensure reliable and reproducible results. When constructing dose-response curves, a concentration range spanning at least six orders of magnitude (typically 10nM to 10mM) provides sufficient data points to accurately determine both threshold sensitivity and maximum response . Each concentration should be tested in at least triplicate, with replicates taken from separate wells containing cells from the same parent plate to account for well-to-well variability while controlling for batch effects . Statistical validation is essential, with established criteria including non-overlapping 95% confidence intervals between top and bottom parameters, standard deviation of the fitted log EC50 less than 1 log unit, and statistical confirmation that receptor activation significantly exceeds vector-only controls using tests such as the extra sums-of-squares test . Researchers should be aware that odorant concentration significantly influences receptor responses, with molecules showing no activity at low concentrations potentially becoming agonists at higher concentrations due to increased probability of receptor-ligand interaction . For stereoisomeric compounds, separate testing of each isomer is crucial, as certain olfactory receptors show differential responses to enantiomers . Additionally, attention to odorant preparation is critical, as many odorants have limited solubility in aqueous solutions and may require careful preparation of stock solutions in DMSO or other appropriate vehicles, with consideration of potential vehicle effects on cellular responses .

What are the challenges in correlating in vitro OR6K3 responses with in vivo olfactory perception?

Translating in vitro findings about OR6K3 activation to in vivo olfactory perception presents several significant challenges that researchers must address. First, heterologous expression systems used for in vitro studies may not fully recapitulate the native cellular environment of olfactory sensory neurons, potentially altering receptor pharmacology—recent research has demonstrated that different cell lines can yield different ligand identification results for the same receptor, highlighting the importance of system selection . Second, concentration effects create complexity, as odorant concentration significantly impacts both receptor activation and perceptual outcomes; an odorant's concentration can alter not only detection thresholds but also perceived hedonic quality and olfactory character . Third, the combinatorial nature of olfactory coding means that individual receptor responses must be integrated into the broader activation pattern across hundreds of receptors to understand perceptual outcomes . Fourth, genetic variation further complicates the picture, as even minor alterations in receptor functionality can lead to notable perceptual consequences between individuals . Fifth, methodological differences between in vitro screening (where odorants are directly applied to cells in solution) versus in vivo olfaction (where odorants must navigate the nasal mucosa to reach receptors) create additional variables that impact relevance of findings . To address these challenges, researchers can employ complementary approaches that combine in vitro receptor characterization with human psychophysical testing of the same compounds, ideally incorporating genetic analysis of OR6K3 variants across test subjects to establish genotype-phenotype correlations .

How does genetic variation in OR6K3 impact ligand binding and receptor function?

Genetic variation in OR6K3 likely plays a significant role in modulating ligand binding properties and receptor function, though specific variants and their functional consequences remain largely unexplored for this particular receptor. Olfactory receptors as a gene family display remarkable genetic and functional diversity across individuals, with variation occurring through both single nucleotide polymorphisms and copy number variations . These genetic differences can manifest as functional alterations in receptor sensitivity, specificity, or signaling efficiency that potentially contribute to individual differences in olfactory perception . When studying OR6K3 variants, researchers should consider both coding region variations that directly affect the protein sequence and regulatory region variations that may influence expression levels. Methodologically, functional characterization of OR6K3 variants would follow approaches used for other olfactory receptors, where variant receptors are expressed in heterologous systems and challenged with the same panel of odorants to identify differences in response profiles . Such experiments typically examine shifts in EC50 values (indicating changes in receptor sensitivity), changes in maximum response (suggesting altered efficacy), or complete loss/gain of response to specific odorants (reflecting altered specificity) . Complementing in vitro studies with human genotype-phenotype correlations can provide particularly valuable insights, potentially linking specific OR6K3 variants to perceptual differences in odor detection thresholds, intensity ratings, or quality descriptors for relevant odorants .

What co-factors and chaperone proteins enhance OR6K3 functional expression?

Successful functional expression of OR6K3 in heterologous systems depends critically on co-expression with appropriate accessory proteins that facilitate receptor trafficking and signaling. Based on established protocols for olfactory receptor expression, the receptor-transporting protein RTP1S represents an essential co-factor that significantly enhances surface expression of olfactory receptors by promoting proper folding and membrane insertion . When designing expression systems for OR6K3, researchers typically co-transfect cells with 5ng/well of RTP1S alongside the receptor construct . Additional accessory factors that improve functional expression include the G-protein Gαolf, which couples olfactory receptors to downstream signaling pathways, and M3, a muscarinic receptor that can enhance signaling through promiscuous G-protein coupling . Specialized cell lines such as Hana3A provide particular advantages for olfactory receptor expression as they have been engineered to express chaperon proteins including RTP1 and RTP2, olfactory G-proteins, and rho tag machinery . The addition of a Rho tag (first 20 residues of human rhodopsin) to the N-terminus of OR6K3 further improves membrane trafficking and can be incorporated into the expression vector during the cloning process . When troubleshooting poor functional expression, researchers should systematically evaluate co-factor levels, considering that optimal ratios of receptor to accessory proteins may vary between different olfactory receptors and might need to be empirically determined for OR6K3 specifically.

What are the best controls to include in OR6K3 activation studies?

Designing rigorous controls for OR6K3 activation studies is essential for generating reliable and interpretable results. Primary negative controls should include mock-transfected cells (vector-only) exposed to the same odorant concentrations as receptor-expressing cells, which accounts for non-specific cellular responses to odorants or vehicles . Positive controls should incorporate well-characterized olfactory receptors with established ligands, such as Olfr544 stimulated with nonanedioic acid, providing validation that the experimental system is functioning as expected . To control for plate-to-plate variability in high-throughput screens, standardization wells containing the same receptor-ligand pair (e.g., three wells of Olfr544 challenged with 10μM nonanedioic acid and three wells with diluent only) should be included on each plate . For normalization of transfection efficiency between wells, co-transfection with constitutively expressed reporters such as Renilla luciferase (pRL-SV40) allows for calculation of normalized luminescence values . When evaluating concentration-dependent effects, vehicle controls at each concentration are necessary to account for potential solvent effects at higher concentrations. Additional specificity controls might include structurally related odorants that should not activate the receptor, providing evidence for the specificity of observed responses. For studies examining receptor variants, wild-type OR6K3 should be included as a reference point for comparing altered response profiles in mutant receptors.

How can computational approaches predict potential OR6K3 ligands?

Computational methods offer valuable strategies for narrowing the vast chemical space of potential OR6K3 ligands prior to experimental validation. While no OR6K3-specific models are currently documented in the literature, general approaches applicable to olfactory receptors can be adapted based on successful precedents with other receptors. Structure-based virtual screening represents one approach, where homology models of OR6K3 are constructed based on available GPCR crystal structures, followed by molecular docking simulations to predict binding affinities of candidate ligands . Ligand-based approaches provide an alternative strategy, utilizing chemoinformatic analysis of known agonists for phylogenetically related olfactory receptors to identify shared structural features that might predict OR6K3 activation . Machine learning models trained on existing odorant-receptor response data, such as that contained in the M2OR database (which includes 75,050 bioassay experiments across 51,395 distinct OR-molecule pairs), can potentially identify patterns that generalize to predict OR6K3 responses . When implementing computational approaches, researchers should consider physiochemical properties relevant to olfaction, including molecular weight, functional groups, and stereochemistry, as well as parameters affecting bioavailability such as volatility and water/lipid partitioning coefficients . Database resources like M2OR (https://m2or.chemsensim.fr/) provide valuable training data and can be used to identify odorants that activate receptors sharing sequence similarity with OR6K3, generating testable hypotheses about potential ligands .

How do different heterologous expression systems compare for OR6K3 functional studies?

The choice of heterologous expression system significantly impacts the outcome of OR6K3 functional studies and requires careful consideration based on experimental objectives. Hana3A cells represent the gold standard for olfactory receptor expression, as they are engineered to express accessory factors including RTP1/RTP2, olfactory G-proteins, and tag-recognition machinery that collectively enhance receptor trafficking and signaling . These cells account for approximately 41% of documented olfactory receptor bioassays in the literature . Standard HEK293T cells provide an alternative but typically require co-transfection with accessory factors to achieve functional expression . Yeast-based systems offer advantages for high-throughput screening but may exhibit different coupling efficiency to mammalian G-proteins . Recent research has revealed significant assay-dependent bias in olfactory receptor responses, with some receptor-ligand pairs identified in one cell type (such as LNCaP prostate carcinoma cells) not replicating in others (like HEK293 cells), highlighting the importance of system selection and validation . Beyond cell type, expression system variables that influence OR6K3 functionality include the promoter driving receptor expression, the presence and type of epitope tags, co-transfected signaling components, and the detection method employed (luciferase, calcium imaging, cAMP measurement, etc.) . When establishing a new expression system for OR6K3, researchers should include positive control receptors with known response profiles to benchmark the system's performance relative to published results.

How can OR6K3 research contribute to understanding the olfactory coding system?

Investigating OR6K3 within the broader context of olfactory coding can provide valuable insights into how the human olfactory system discriminates thousands of odors using a limited receptor repertoire. As part of the combinatorial coding mechanism, where each odorant activates multiple receptors and each receptor responds to multiple odorants, characterizing OR6K3's response profile would add another piece to the complex puzzle of olfactory perception . By integrating OR6K3 response data into comprehensive databases like M2OR, researchers can analyze response patterns across the receptor family, potentially revealing shared tuning properties among phylogenetically related receptors or identifying previously unrecognized response clusters that correlate with perceptual qualities . Studies examining OR6K3 genetic variants across populations could contribute to understanding the molecular basis of individual differences in olfactory perception, particularly if variants exhibit altered response profiles to specific odorants . Additionally, OR6K3 research could address fundamental questions about structure-function relationships in olfactory receptors by identifying which structural features determine ligand specificity and how sequence variations translate to functional differences . From a methodological perspective, developing effective expression and assay systems for understudied receptors like OR6K3 advances the technical toolkit available to the field, potentially accelerating the pace of receptor deorphanization efforts . Integration of OR6K3 findings with data from other receptors could ultimately contribute to predictive models of olfactory perception based on chemical structure, advancing both basic understanding of sensory coding and potential applications in flavor and fragrance development .

How should researchers interpret contradictory data when studying OR6K3?

When confronted with contradictory results in OR6K3 studies, researchers should systematically evaluate methodological differences that might explain discrepancies rather than immediately discounting conflicting findings. One significant source of contradictions in olfactory receptor research stems from differences in expression systems, as recent studies have demonstrated that the same receptor can yield different ligand recognition profiles when expressed in different cell lines . Concentration effects represent another common source of apparent contradictions, as odorants that fail to activate a receptor at low concentrations may become effective agonists at higher concentrations, requiring careful comparison of tested concentration ranges across studies . Stereochemical differences in test compounds can lead to contradictory results when stereochemistry is incompletely specified, as some olfactory receptors show differential responses to enantiomers . Differences in assay readouts (calcium imaging versus cAMP or luciferase measurements) may also contribute to discrepancies, as these methods detect different points in the signaling cascade with varying sensitivity and temporal resolution . When evaluating contradictory findings, researchers should consider genetic variations in the receptor sequence used across studies, as even single amino acid differences can alter response profiles . A structured approach to resolving contradictions includes direct replication attempts that systematically vary individual parameters to identify the critical variables driving different outcomes. Publishing negative results alongside positive findings is particularly valuable in this field, as the M2OR database demonstrates by including non-responsive OR-molecule pairs that represent approximately 94% of documented receptor-odorant interactions .

What technology developments would advance OR6K3 research?

Several technological advances would significantly accelerate research on OR6K3 and other understudied olfactory receptors. Development of improved heterologous expression systems with enhanced trafficking and coupling efficiency would address a fundamental bottleneck in the field, potentially through engineered cell lines with optimized levels of accessory proteins specific for different olfactory receptor subfamilies . High-throughput screening platforms capable of testing thousands of odorants against OR6K3 at multiple concentrations would dramatically expand the search for ligands, particularly if coupled with automated analysis pipelines that apply consistent criteria for identifying true positives . Advanced structural biology techniques applied to olfactory receptors, including cryo-electron microscopy or innovative crystallization approaches, could potentially reveal the three-dimensional structure of OR6K3, transforming structure-based approaches to ligand discovery . Single-cell transcriptomics and functional imaging of native olfactory sensory neurons expressing OR6K3 would provide insights into its expression patterns and in vivo response properties, connecting molecular mechanisms to cellular physiology . Improved computational methods that accurately predict olfactory receptor-ligand interactions based on receptor sequence and ligand structure would streamline the search for agonists, particularly if trained on expanded datasets of receptor-ligand pairs . Development of OR6K3-specific antibodies with validated specificity would enable immunohistochemical studies of receptor localization and expression levels across tissues . Integration of these technological advances with standardized data reporting formats would facilitate comparison across studies and accelerate progress in understanding this understudied receptor.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.