Recombinant Human Olfactory receptor 6N2 (OR6N2)

Shipped with Ice Packs
In Stock

Description

Introduction to Olfactory Receptors and OR6N2

Olfactory receptors (ORs) constitute the primary chemosensory receptor family responsible for the human sense of smell. Humans possess approximately 400 different functional olfactory receptors that collectively enable the detection and discrimination of thousands of odorant molecules . These receptors form the foundation of our olfactory perception system, translating chemical stimuli into neural signals that the brain interprets as distinct odors. Within this diverse receptor family, OR6N2 (Olfactory Receptor Family 6 Subfamily N Member 2) emerges as a distinct receptor with specific expression patterns and ligand responses.

The recombinant form of OR6N2 has become an essential tool for investigating the receptor's structural and functional properties in controlled laboratory conditions. Through recombinant expression, researchers can produce the receptor protein in heterologous cell systems, enabling detailed studies of its interactions with odorants, signal transduction mechanisms, and potential roles in various physiological and pathological processes.

Genetic and Evolutionary Context

OR6N2 belongs to family 6, subfamily N of the olfactory receptor gene superfamily. This classification reflects its sequence similarity to other ORs and evolutionary relationships. The gene encoding OR6N2 is located within one of several OR gene clusters in the human genome, consistent with the evolutionary history of ORs through gene duplication events.

Challenges in Recombinant Expression

A significant challenge in studying OR6N2 and other olfactory receptors has been their poor heterologous expression, particularly regarding cell surface localization. This limitation has hampered functional studies and structure determination efforts. Several factors contribute to this challenge:

  1. Inefficient trafficking to the plasma membrane

  2. Protein misfolding and aggregation

  3. Retention in the endoplasmic reticulum

  4. Low transcription efficiency

These challenges have necessitated the development of specialized expression systems and strategies to enhance OR6N2 production and functional studies.

Enhanced Expression Systems

Recent research has demonstrated that the TAR-Tat system significantly improves the expression of OR6N2 in heterologous cell systems. This approach focuses on enhancing transcriptional efficiency through positive feedback mechanisms. In comparative studies, OR6N2 showed higher baseline cell surface expression compared to some other ORs (e.g., OR1A1), suggesting inherent properties that facilitate its membrane trafficking .

When expressed using the TAR-Tat system, OR6N2 exhibited approximately 9-fold higher expression levels compared to conventional expression systems . This enhancement represents a significant advancement for functional studies, enabling more robust responses in ligand screening assays.

Table 1: OR6N2 Expression Enhancement with TAR-Tat System

Expression SystemRelative Expression LevelFold Increase
ConventionalBaseline
TAR-Tat SystemEnhanced~9×

Other approaches to enhance OR6N2 expression include co-expression with chaperone proteins such as Receptor Transporting Protein 1 Short (RTP1S), which facilitates trafficking to the cell surface. Additionally, N-terminal modifications, such as fusion with rhodopsin tags, have shown efficacy in improving membrane localization of olfactory receptors including OR6N2 .

Ligand Interactions

Understanding the ligand specificity of OR6N2 remains a developing area of research. While the complete profile of compounds that activate OR6N2 has not been fully characterized, studies using enhanced expression systems have enabled more sensitive detection of receptor responses to various odorants.

Research utilizing the TAR-Tat expression system has facilitated improved detection of OR6N2 responses to odorants that might have been previously undetectable with conventional assay systems. This sensitivity enhancement is particularly valuable for receptors like OR6N2 that may exhibit lower response magnitudes or require higher odorant concentrations for activation .

Signal Transduction Mechanisms

Upon activation by appropriate ligands, OR6N2 couples to Gαolf, a specialized G protein involved in olfactory signal transduction. This interaction triggers adenylyl cyclase, leading to increased cAMP production, which subsequently activates cyclic nucleotide-gated channels. The resulting ion flux leads to depolarization of the olfactory sensory neuron and signal propagation to the brain.

The efficiency of this signaling cascade can be enhanced in recombinant systems through co-expression with signal-enhancing components such as Gαolf and Ric-8b, which amplify the downstream response to receptor activation .

Chemical Modulation of OR6N2

Several chemicals have been identified that affect OR6N2 expression or regulation, indicating potential environmental influences on this receptor. These interactions may have implications for olfactory function and other physiological processes involving OR6N2.

Table 2: Chemicals Affecting OR6N2 Expression and Regulation

ChemicalEffectMechanismReference
1,2-dichloroethaneDecreased expressionTranscriptional regulation
AcrylamideDecreased expressionTranscriptional regulation
Benzo[a]pyreneIncreased methylationEpigenetic modification
Bisphenol ADecreased expression & Increased methylationTranscriptional & Epigenetic regulation
Chromium(6+)Affects expressionMultiple mechanisms
Valproic acidDecreased methylationEpigenetic modification

These chemical interactions suggest that OR6N2 expression and function may be modulated by environmental exposures, potentially affecting olfactory perception and other OR6N2-mediated processes.

Epigenetic Regulation

The methylation status of OR6N2 appears to be affected by various environmental chemicals, suggesting epigenetic regulation as an important mechanism controlling its expression. Bisphenol A and benzo[a]pyrene have been shown to increase methylation of the OR6N2 promoter and/or exonic regions, potentially suppressing gene expression . Conversely, valproic acid decreases OR6N2 methylation, which may enhance expression. These epigenetic modifications represent potential mechanisms through which environmental factors could influence OR6N2 function and related physiological processes.

Olfactory Research Applications

Recombinant OR6N2 serves as a valuable tool for fundamental research on human olfaction. By expressing this receptor in heterologous cell systems, researchers can investigate:

  1. Mechanisms of odorant recognition and discrimination

  2. Structure-function relationships in olfactory receptors

  3. Receptor response patterns to complex odors

  4. Comparative olfactory receptor function across species

Recent advancements in expression systems, particularly the TAR-Tat system, have enhanced the utility of recombinant OR6N2 for these research applications by improving expression levels and functional responses .

Potential Therapeutic Applications

The extranasal expression of olfactory receptors, potentially including OR6N2, in tissues such as the brain, pancreas, and testes suggests possible roles beyond olfaction . These non-olfactory functions may have implications for various physiological and pathological processes, opening avenues for therapeutic interventions targeting OR6N2.

Additionally, understanding how chemicals modulate OR6N2 expression and function could inform strategies to address olfactory disorders associated with environmental exposures or other triggers. The identification of specific agonists or antagonists for OR6N2 could potentially lead to the development of compounds that modulate its activity for therapeutic purposes.

Industrial Applications

Knowledge of OR6N2's response profile to various odorants could have applications in the flavor and fragrance industry. By characterizing its activation by specific compounds, researchers might develop more precise odor formulations or identify novel masking agents for unpleasant odors.

For instance, research has identified n-hexanal as a significant off-flavor compound in soybeans, and understanding the response of olfactory receptors to this compound could facilitate the development of masking strategies for applications such as plant-based meat products .

Comprehensive Ligand Profiling

Enhanced expression systems like TAR-Tat offer opportunities for more comprehensive screening of potential OR6N2 ligands, potentially identifying novel agonists, antagonists, or inverse agonists. Such profiling would contribute to a more complete understanding of OR6N2's role in odor perception and potential extranasal functions.

Investigation of Non-olfactory Functions

Further research into the expression and function of OR6N2 in extranasal tissues could reveal novel physiological roles and disease associations. This exploration may open new avenues for therapeutic interventions targeting OR6N2 in various disease contexts.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
OR6N2; Olfactory receptor 6N2; Olfactory receptor OR1-23
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
OR6N2
Target Protein Sequence
MDQYNHSSLAEFVFLGFASVGYVRGWLFVLLLLAYLFTICGNMLIFSVIRLDAALHTPMY HFVSVLSFLELWYTATTIPKMLSNILSEKKTISFAGCLLQTYFFHSLGASECYLLTAMAY DRYLAICRPLHYPIIMTTTLCAKMAAACWTCGFLCPISEVILASQLPFCAYNEIQHIFCD FPPLLSLACKDTSANILVDFAINAFIILITFFFIMISYARIIGAVLKIKTASGRKKAFST CASHLAVVLIFFGSIIFMYVRLKKSYSLTLDRTLAIVYSVLTPMVNPIIYSLRNKEIIKA IKRTIFQKGDKASLAHL
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links

HGNC: 15035

KEGG: hsa:81442

STRING: 9606.ENSP00000344101

UniGene: Hs.554487

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural classification of human OR6N2?

Human OR6N2 (UniProt ID: Q8NGY6) belongs to the class II olfactory receptor family 6, subfamily N, member 2. It is a G protein-coupled receptor (GPCR) with seven transmembrane domains characteristic of the olfactory receptor superfamily. OR6N2 is also known by the synonym "Olfactory receptor OR1-23" . Structurally, it follows the typical GPCR architecture with an extracellular N-terminus, seven α-helical transmembrane domains, and an intracellular C-terminus that interacts with G proteins to initiate signal transduction. The receptor is encoded by the OR6N2 gene located in the human genome and is classified within the larger OR6 gene family, one of the nine OR gene families in Class II receptors .

How does OR6N2 fit into the evolutionary context of olfactory receptors?

OR6N2 is part of the OR6 gene family within the broader context of olfactory receptor evolution. Olfactory receptor genes follow a "birth and death" model of gene evolution, expanding through processes such as tandem gene duplication . This evolutionary pattern has resulted in the current diversity of OR genes in humans, with approximately 400 different functional olfactory receptors. Within this evolutionary framework, the OR6 family represents one branch of the Class II (non-fish-like) olfactory receptors, which comprise the majority of human ORs. Each OR family has undergone species-specific duplications and losses, contributing to the unique olfactory capabilities and limitations of different species. The study of OR6N2 within this evolutionary context provides insights into how sensory perception has evolved in primates and specifically in humans.

What factors influence the expression of OR6N2 in heterologous cell systems?

The expression of OR6N2 in heterologous cell systems faces several challenges that researchers must address. One fundamental issue is the poor cell surface expression typically observed with human olfactory receptors. Recent research has demonstrated that increasing transcriptional efficiency can significantly enhance both the surface expression and functional activity of OR6N2 .

Specifically, the implementation of the TAR-Tat system, which operates through a positive feedback mechanism, has been shown to substantially improve OR6N2 expression. This system enhances transcription efficiency, resulting in higher protein production and subsequently greater cell surface localization . Other factors that influence expression include:

  • The choice of heterologous expression system (HEK293 cells are commonly used)

  • The presence of chaperone proteins that assist with proper folding and trafficking

  • The use of fusion partners or N-terminal tags to enhance membrane targeting

  • Culture conditions including temperature and induction timing

  • The composition of the expression vector, including promoter strength and codon optimization

Methodologically, researchers can optimize these factors through systematic testing of different expression constructs and conditions, monitoring both total protein expression and cell surface localization through techniques such as flow cytometry and fluorescence microscopy.

How do environmental chemicals impact OR6N2 expression and function?

Environmental chemicals have been shown to significantly impact OR6N2 expression through various mechanisms. According to gene-chemical interaction studies, several compounds affect OR6N2 at both the transcriptional and epigenetic levels:

ChemicalEffect on OR6N2MechanismEvidence Type
1,2-dichloroethaneDecreased expressionTranscriptional downregulationISO (inferred from sequence orthology)
AcrylamideDecreased expressionTranscriptional downregulationEXP (experimental evidence)
Benzo[a]pyreneIncreased methylationEpigenetic modification of exon and promoterISO
Bisphenol ADecreased expressionTranscriptional downregulationEXP
Bisphenol AIncreased methylationEpigenetic modification of promoterISO
Chromium(6+)Affects expressionMultiple potential mechanismsISO
Titanium dioxide with Azoxymethane and Dextran SulfateDecreased expressionComplex interaction effectsISO

These chemical interactions suggest that OR6N2 expression can be modulated by environmental exposures, potentially affecting olfactory function. Methodologically, researchers can investigate these effects through:

  • In vitro exposure studies using OR6N2-expressing cell lines

  • Methylation analysis of the OR6N2 promoter and gene body

  • Transcriptional profiling following chemical exposure

  • Functional assays to assess receptor activity after chemical exposure

  • In vivo studies examining olfactory function in animal models exposed to these chemicals

Understanding these chemical interactions is critical for assessing potential environmental impacts on olfactory function and for developing strategies to mitigate adverse effects.

What epigenetic mechanisms regulate OR6N2 expression?

Epigenetic regulation plays a crucial role in controlling OR6N2 expression, with DNA methylation being a particularly important mechanism. Research has shown that several environmental chemicals can alter the methylation status of the OR6N2 gene:

  • Benzo[a]pyrene has been demonstrated to increase methylation of both the OR6N2 exon and promoter regions .

  • Bisphenol A exposure results in increased methylation specifically of the OR6N2 promoter region .

These methylation changes correlate with alterations in gene expression, suggesting a causal relationship between epigenetic modifications and transcriptional regulation. Beyond DNA methylation, other potential epigenetic mechanisms may include:

  • Histone modifications affecting chromatin accessibility at the OR6N2 locus

  • Non-coding RNAs that modulate OR6N2 mRNA stability or translation

  • Chromatin remodeling complexes that alter the three-dimensional organization of the OR6N2 genomic region

Methodologically, researchers can investigate these epigenetic mechanisms through:

  • Bisulfite sequencing to map DNA methylation patterns

  • Chromatin immunoprecipitation (ChIP) to analyze histone modifications

  • Chromosome conformation capture techniques to examine three-dimensional chromatin organization

  • RNA-seq to identify non-coding RNAs potentially involved in OR6N2 regulation

  • CRISPR-based epigenetic editing to directly test the functional consequences of specific epigenetic modifications

Understanding these epigenetic regulatory mechanisms provides insight into both the developmental regulation of OR6N2 and its potential dysregulation in response to environmental exposures.

How can the TAR-Tat system enhance OR6N2 expression for functional studies?

The TAR-Tat system represents a significant advancement in overcoming the challenging expression of human olfactory receptors, including OR6N2. This system increases transcription efficiency through a positive feedback mechanism, resulting in substantially improved cell surface expression and functional activity .

The methodological implementation of the TAR-Tat system involves:

  • Construction of the expression vector: The OR6N2 coding sequence is placed under the control of a promoter containing the TAR (Trans-Activation Response) element.

  • Co-expression with Tat protein: The Tat (Trans-Activator of Transcription) protein binds to the TAR element and greatly enhances transcriptional activity.

  • Positive feedback loop creation: As more Tat protein is produced, transcription is further enhanced, creating an amplification effect.

  • Cell transfection and culture: Optimized transfection protocols deliver the construct to heterologous cells (typically HEK293 cells).

  • Expression verification: Surface expression can be confirmed through techniques such as immunofluorescence microscopy or flow cytometry using epitope-tagged OR6N2.

The TAR-Tat system has demonstrated robust expression of OR6N2, significantly enhancing its functional response to odorants . This improved expression system has enabled the identification of novel ligand-receptor interactions that were previously undetectable due to insufficient receptor expression. The methodological advantage of this system is particularly valuable for deorphanizing olfactory receptors and establishing comprehensive odorant-receptor response profiles.

What methods are most effective for identifying OR6N2 ligands?

Identifying ligands for OR6N2 requires specialized methodologies that can detect the often subtle responses of olfactory receptors to potential odorants. Several approaches have proven effective:

  • Calcium imaging: By co-expressing OR6N2 with a calcium-sensitive fluorescent indicator in heterologous cells, researchers can monitor intracellular calcium flux in response to potential ligands. This method benefits from the enhanced expression achieved through the TAR-Tat system .

  • cAMP assays: Since olfactory receptors signal through Gαolf and increase cAMP levels, assays measuring cAMP production (such as ELISA-based methods or cAMP-responsive reporter systems) can identify receptor activation.

  • Luciferase reporter systems: These involve co-expression of OR6N2 with a construct containing a cAMP-responsive element driving luciferase expression, allowing for quantification of receptor activation through luminescence measurements.

  • Electrophysiological recordings: Patch-clamp techniques can measure electrical responses in cells expressing OR6N2, providing high temporal resolution of receptor activation.

  • BRET/FRET-based assays: These techniques monitor protein-protein interactions involved in GPCR signaling cascades, offering insights into receptor conformational changes upon ligand binding.

Recent research using these methods has identified n-hexanal as a ligand for several human olfactory receptors . For OR6N2 specifically, the use of the TAR-Tat expression system has enabled more robust functional testing that may reveal previously undetected ligand interactions.

When implementing these methods, researchers should:

  • Test a diverse panel of odorants at various concentrations

  • Include appropriate positive and negative controls

  • Validate responses with multiple methodological approaches

  • Consider receptor desensitization and potential for non-specific effects

  • Account for endogenous receptor expression in the chosen cell system

What protein purification strategies are most suitable for recombinant OR6N2?

Purification of recombinant OR6N2 presents significant challenges common to membrane proteins, particularly GPCRs. Effective strategies must balance protein yield, purity, stability, and retention of native conformation. The following methodological approaches have proven successful for olfactory receptor purification:

  • Detergent-based solubilization:

    • Initial screening of multiple detergents (e.g., DDM, CHAPS, Triton X-100) to identify optimal solubilization conditions

    • Careful optimization of detergent concentration to maximize extraction while minimizing denaturation

    • Addition of cholesterol or cholesteryl hemisuccinate to stabilize the receptor

  • Affinity chromatography:

    • Use of fusion tags such as polyhistidine (His6/His10), FLAG, or rho1D4 for initial capture

    • Tandem affinity purification using multiple tags to increase purity

    • Site-specific biotinylation combined with streptavidin chromatography for enhanced selectivity

  • Size exclusion chromatography (SEC):

    • Critical for separating monomeric receptor from aggregates

    • Assessment of protein monodispersity as a quality control measure

    • Analysis of receptor-detergent complex stability

  • Lipid reconstitution:

    • Incorporation into nanodiscs or liposomes to provide a native-like membrane environment

    • Use of lipid cubic phase for structural studies

    • Selection of lipid composition to enhance stability and activity

For optimal results, researchers should implement:

  • Extensive construct optimization (e.g., truncations, thermostabilizing mutations)

  • Expression in specialized systems (insect cells, mammalian cells)

  • Strict temperature control during all purification steps

  • Addition of ligands during purification to stabilize active conformations

  • Comprehensive quality control using multiple biophysical techniques (SEC-MALS, CD spectroscopy, thermal stability assays)

While specific protocols optimized for OR6N2 are not detailed in the provided search results, these general approaches have been successfully applied to other olfactory receptors and GPCRs.

How can OR6N2 research contribute to understanding broader olfactory coding mechanisms?

OR6N2 research provides a valuable model for investigating the fundamental principles of olfactory coding. As one of approximately 400 human olfactory receptors, OR6N2 contributes to the combinatorial code that enables humans to distinguish thousands of different odors . Several advanced research applications can leverage OR6N2 studies to illuminate broader olfactory coding mechanisms:

  • Combinatorial receptor activation patterns: By studying how OR6N2 responds to diverse odorants, particularly in combination with other characterized ORs, researchers can map combinatorial activation patterns that define odor perception. This requires developing high-throughput functional assays to simultaneously monitor multiple receptors.

  • Structure-function relationships: Comparative analysis of OR6N2 with other olfactory receptors can reveal critical structural determinants of ligand specificity. Homology modeling, molecular docking, and site-directed mutagenesis approaches can identify key binding pocket residues that dictate odorant recognition.

  • Signal transduction mechanisms: Investigation of OR6N2 signaling dynamics, including temporal aspects of activation, desensitization, and adaptation, provides insight into how olfactory information is processed at the receptor level before transmission to the brain.

  • Species-specific olfactory capabilities: Comparative analysis of OR6N2 orthologs across species can reveal evolutionary adaptations in olfactory function. These comparisons may highlight how selective pressures have shaped olfactory perception in different ecological niches.

  • Integration with neuronal circuit models: Combining OR6N2 activation data with neuroanatomical mapping of olfactory bulb projections can help construct comprehensive models of how peripheral receptor activation translates to central odor processing.

Methodologically, these applications require integration of multiple experimental approaches, including heterologous expression systems, in vivo models, computational modeling, and potentially human psychophysical studies to connect molecular mechanisms to perceptual outcomes.

What are the challenges in correlating OR6N2 genetic variations with olfactory phenotypes?

Correlating OR6N2 genetic variations with specific olfactory phenotypes presents several methodological challenges that researchers must address:

  • Genetic complexity of olfactory perception: Olfactory perception involves approximately 400 different olfactory receptors functioning in a combinatorial manner, making it difficult to isolate the specific contribution of OR6N2 variations . Multiple receptors may recognize the same odorant with different affinities, creating redundancy in the system.

  • Functional validation of variants: Determining how specific OR6N2 variants affect receptor function requires robust heterologous expression systems that accurately model in vivo receptor behavior. The TAR-Tat system provides a methodological advantage here by enabling enhanced expression for functional testing .

  • Phenotypic assessment limitations: Olfactory phenotyping in humans relies largely on subjective measures with significant individual variability. Developing standardized, quantitative phenotyping methods is essential for reliable genotype-phenotype correlations.

  • Population genetics considerations: The frequency of OR6N2 variants differs across populations, necessitating diverse cohorts for comprehensive studies. Environmental factors may also interact with genetic variations, further complicating analysis.

  • Epigenetic influences: As demonstrated by studies showing chemical-induced methylation changes in OR6N2 , epigenetic modifications may influence receptor expression independently of genetic sequence, requiring integrated genetic and epigenetic analyses.

Methodological approaches to address these challenges include:

  • Comprehensive sequencing of OR6N2 in diverse populations

  • Functional characterization of variants using the TAR-Tat expression system

  • Development of high-throughput, quantitative olfactory phenotyping methods

  • Integration of genetic, epigenetic, and environmental exposure data

  • Application of systems biology approaches to model the contribution of OR6N2 within the broader olfactory receptor network

How can OR6N2 be utilized in biosensor development for environmental monitoring?

The potential application of OR6N2 in biosensor development represents an emerging frontier in environmental monitoring technology. Based on its interaction with various environmental chemicals as documented in gene-chemical interaction studies , OR6N2 could serve as a biological recognition element for detecting specific compounds. The methodological approach to developing OR6N2-based biosensors involves several strategic steps:

  • Receptor optimization:

    • Implementation of the TAR-Tat system to enhance receptor expression and functionality

    • Potential protein engineering to improve stability and sensitivity

    • Creation of fusion constructs with reporter elements for signal transduction

  • Signal transduction platforms:

    • Coupling OR6N2 activation to electrical, optical, or mechanical transduction mechanisms

    • Options include:

      • Cell-based biosensors using calcium imaging or impedance measurements

      • Cell-free systems with purified receptor incorporated into artificial membrane platforms

      • Field-effect transistor (FET) biosensors with immobilized receptors

      • Surface plasmon resonance (SPR) detection systems

  • Specificity profiling:

    • Comprehensive characterization of OR6N2 responses to environmental chemicals

    • Development of "fingerprinting" approaches using multiple receptors for improved discrimination

    • Computational modeling to predict receptor-ligand interactions

  • Performance optimization:

    • Enhancement of detection limits through signal amplification strategies

    • Improvement of response time and recovery kinetics

    • Development of calibration methods for quantitative measurements

    • Stability enhancement for field deployment

This application is particularly relevant given OR6N2's documented interactions with environmentally significant compounds such as benzo[a]pyrene, bisphenol A, and chromium(6+) . The receptor's sensitivity to these compounds suggests potential utility in monitoring environmental contaminants that may impact human health.

Methodological challenges that must be addressed include:

  • Maintaining receptor stability in environmental sampling conditions

  • Distinguishing specific signals from background noise

  • Developing suitable immobilization strategies for the receptor

  • Creating appropriate controls to validate sensor responses

  • Engineering systems for continuous or repeated measurements

What emerging technologies can advance OR6N2 structural studies?

Several emerging technologies hold promise for advancing structural studies of OR6N2, potentially overcoming the significant challenges associated with membrane protein structural determination:

  • Cryo-electron microscopy (cryo-EM) advancements:

    • Latest developments in single-particle cryo-EM have enabled structure determination of increasingly smaller membrane proteins

    • Application of micro-electron diffraction (microED) to small crystals

    • Development of improved sample preparation methods specifically for GPCRs

    • Computational approaches for enhancing resolution in heterogeneous samples

  • Integrated structural biology approaches:

    • Combination of X-ray crystallography, cryo-EM, and NMR spectroscopy

    • Incorporation of molecular dynamics simulations to model flexible regions

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for dynamics analysis

    • Cross-linking mass spectrometry to define tertiary structure constraints

  • Novel expression and stabilization strategies:

    • Further refinement of the TAR-Tat system specifically for structural biology applications

    • Development of conformational stabilization through nanobodies or synthetic binding proteins

    • Implementation of systematic mutagenesis to identify thermostabilizing mutations

    • Application of directed evolution approaches to generate stable variants

  • Advanced computational methods:

    • AlphaFold2 and other AI-based prediction tools customized for olfactory receptors

    • Molecular dynamics simulations incorporating lipid bilayers

    • Enhanced sampling techniques to explore conformational landscapes

    • Integrative modeling incorporating sparse experimental constraints

Methodologically, researchers should consider combining multiple approaches to overcome the inherent difficulties in membrane protein structural biology. The TAR-Tat system's ability to enhance expression levels provides a promising foundation for structural studies by addressing the fundamental challenge of producing sufficient quantities of properly folded receptor .

How might OR6N2 research contribute to personalized medicine approaches?

OR6N2 research has significant potential to contribute to personalized medicine approaches through several innovative pathways:

  • Olfactory phenotyping as a diagnostic tool:

    • Variations in OR6N2 function may contribute to individual differences in odor perception

    • These differences could potentially serve as biomarkers for certain neurological conditions

    • Methodological approach: Development of standardized olfactory testing protocols specifically targeting OR6N2-mediated perception

  • Pharmacogenomic applications:

    • OR6N2 genetic variants may influence individual responses to certain medications

    • Chemical-gene interactions documented for OR6N2 suggest potential involvement in xenobiotic metabolism pathways

    • Methodological approach: Integration of OR6N2 genotyping in clinical pharmacogenomic panels

  • Environmental exposure assessment:

    • OR6N2 methylation patterns change in response to environmental chemicals like benzo[a]pyrene and bisphenol A

    • These epigenetic modifications could serve as biomarkers of exposure

    • Methodological approach: Development of epigenetic assays specific to the OR6N2 locus for exposure monitoring

  • Neurological disease connections:

    • Olfactory dysfunction often precedes other symptoms in neurodegenerative diseases

    • Specific OR6N2 variants or expression patterns might correlate with disease risk or progression

    • Methodological approach: Longitudinal studies correlating OR6N2 function with neurodegenerative disease outcomes

  • Therapeutic targeting:

    • Enhanced understanding of OR6N2 signaling pathways may reveal novel therapeutic targets

    • The TAR-Tat system could potentially be adapted for therapeutic gene delivery applications

    • Methodological approach: High-throughput screening for compounds that modulate OR6N2 activity in a therapeutic context

Implementation of these personalized medicine approaches would require integration of genetic, epigenetic, functional, and clinical data. The enhanced expression systems like TAR-Tat provide crucial methodological tools for functional characterization of OR6N2 variants identified in patient populations .

What are the potential applications of OR6N2 in artificial olfaction systems?

The integration of OR6N2 into artificial olfaction systems represents an exciting frontier in biomimetic sensor technology. By leveraging the natural selectivity and sensitivity of olfactory receptors, these systems aim to replicate aspects of biological olfaction for various applications. Several methodological approaches show promise:

  • Cell-free receptor-based sensing platforms:

    • Purified OR6N2 incorporated into lipid bilayer systems

    • Integration with electronic transduction elements (bioelectronic noses)

    • Methodological requirements: Development of stable receptor preparations and sensitive transduction mechanisms

  • Cell-based sensor arrays:

    • Arrays of cells expressing OR6N2 alongside other olfactory receptors

    • Implementation of the TAR-Tat system to enhance receptor expression and function

    • Pattern recognition algorithms to process combinatorial responses

    • Methodological approach: Optimization of cell immobilization, viability maintenance, and response recording

  • Hybrid biological-electronic systems:

    • Direct coupling of OR6N2 to nanomaterials such as carbon nanotubes or graphene

    • Development of field-effect transistor (FET) configurations with receptor functionalization

    • Methodological challenges: Achieving oriented receptor immobilization while maintaining function

  • OR6N2-inspired synthetic receptors:

    • Computational design of synthetic receptors mimicking OR6N2 binding properties

    • Development of molecularly imprinted polymers (MIPs) based on OR6N2 binding pocket structure

    • Methodological approach: Structure-based design informed by OR6N2 binding studies

Potential applications include:

  • Environmental monitoring, particularly for compounds known to interact with OR6N2 such as benzo[a]pyrene and bisphenol A

  • Food quality assessment and authentication

  • Medical diagnostics based on volatile biomarkers

  • Security and threat detection

  • Industrial process monitoring

The recent advances in enhancing OR6N2 expression through systems like TAR-Tat directly address one of the major limitations in developing olfactory receptor-based sensors: obtaining sufficient functional receptor for device integration. This breakthrough may accelerate progress toward practical artificial olfaction systems incorporating OR6N2 and other human olfactory receptors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.